Pay in installments of $28.12 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 18 - Aug 23
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human BTN3A1, hFc tagProduct Specification Species Human Synonyms Butyrophilin subfamily 3 member A1, CD277, BTF5 Accession O00481 Amino Acid Sequence Protein sequence (O00481, Gln30 Gly254, with C hFc)
Product Specification
| Species | Human |
| Synonyms | Butyrophilin subfamily 3 member A1, CD277, BTF5 |
| Accession | O00481 |
| Amino Acid Sequence | Protein sequence (O00481, Gln30-Gly254, with C-hFc) QFSVLGPSGPILAMVGEDADLPCHLFPTMSAETMELKWVSSSLRQVVNVYADGKEVEDRQSAPYRGRTSILRDGITAGKAALRIHNVTASDSGKYLCYFQDGDFYEKALVELKVAALGSDLHVDVKGYKDGGIHLECRSTGWYPQPQIQWSNNKGENIPTVEAPVVADGVGLYAVAASVIMRGSSGEGVSCTIRSSLLGLEKTASISIADPFFRSAQRWIAALAGEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 50.2 kDa Observed MW: 55 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-hFc |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Human butyrophilin subfamily 3 member A (BTN3A), also known as CD277, includes isoforms BTN3A1, BTN3A2, and BTN3A3 and is structurally associated with B7 costimulatory molecules. Each BTN3A isoform consists of an extracellular N-terminal Ig variable (V) domain and a near-membrane Ig constant (C) region connected to a single transmembrane domain. BTN3A family members have emerged as important molecules modulating the function of Vγ9Vδ2 T cells. The B30.2 intracellular domain plays an important role in this process. Only the intracellular B30.2 domain of BTN3A1 directly binds phosphorylated antigens (pAgs) through a positively charged pocket to activate Vγ9Vδ2 T cells. BTN3A1 is expressed in many tumors, such as ovarian cancer, bladder cancer, breast cancer, renal cell carcinoma and pancreatic ductal adenocarcinoma. The prognostic role of BTN3A1 in different cancers varies substantially.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy