Pay in installments of $68.75 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 12 - Aug 17
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Frizzled-7/FZD7 His Tag Protein, HumanProduct Specification Species Human Synonyms FZD7, Frizzled 7, FzE3, Fz 7, hFz7 Accession O75084 Amino Acid Sequence Gln33 Leu185, with C terminal 8*His QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 33kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag
Product Specification
| Species | Human |
| Synonyms | FZD7, Frizzled-7, FzE3, Fz-7, hFz7 |
| Accession | O75084 |
| Amino Acid Sequence | Gln33-Leu185, with C-terminal 8*His QPYHGEKGISVPDHGFCQPISIPLCTDIAYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPCRSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYPTAPYLGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 25-33kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Sagara N. et al. (1998) Molecular cloning, differential expression, and chromosomal localization of human frizzled-1, frizzled-2, and frizzled-7. Biochem Biophys Res Commun. 252(1): 117-122. |
Background
Frizzled-7 is a member of the Frizzled family of unconventional G-protein-coupled glycoprotein receptors for the Wnt signaling pathway. The Wnt genes encode a large family of glycoproteins that are essential in development and tissue maintenance. In the adult, Frizzled-7 is expressed in skeletal muscle, especially in satellite cells that mediate muscle regeneration in response to Wnt-7a. It is expressed in embryonic stem cells (ES), contributing to self-renewal signaling. It has been implicated in mesenchymal-to-epithelial transition in colorectal cancer. Frizzled-7 mRNA has also been detected in adult heart and placenta.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 30 reviews
Sort
Product Reviews
★★★★★ 5
So easy and convenient for everyday bottle washing
I’ve been using these Momcozy washing blocks with the KleanPal Pro baby bottle washer, and they work exactly as intended. The tablets dissolve fully during the wash and leave bottles, pump parts, and accessories coming out clean with no residue or strong scent.
What I like most is the convenience. There’s no measuring or spilling liquid detergent, and each tablet is perfectly portioned. It makes the whole washing process quicker and more consistent, especially when you’re washing bottles multiple times a day.
They’ve been gentle on all of my baby items and haven’t caused any cloudiness or buildup on bottles or nipples. Overall, these are a simple and reliable refill to keep the washer running smoothly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 4, 2026
★★★★★ 5
Compact and comes with many!
I recently tried the Mom Cozy detergent blocks for the bottle washer, and I'm thoroughly impressed. These tiny blocks come in small, compact bags, making them incredibly easy to store and use. Despite their size, they pack a powerful cleaning punch, leaving bottles sparkling clean and free of residue.
I love how convenient they are – just pop one into the washer, and you're good to go. Plus, the fact that they come in bags with many blocks ensures I won't run out anytime soon. If you're looking for a hassle-free and effective cleaning solution for your baby bottles, these Mom Cozy detergent blocks are a must-try!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 15, 2026
★★★★★ 5
Great cleaner
Great great! Cleans perfectly and easy to use, just drop it in the bottle washer. Super time saving and great value.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
★★★★★ 5
A Game-Changer for Breastfeeding Moms!
I was a bit skeptical about buying a specialized bottle washing block at first, but I'm so glad I took the plunge! The Momcozy Official Washing Block is a total game-changer for breastfeeding moms like myself. This product has made my life as a nursing mom so much easier and more convenient.
First of all, let me just say that this block is SUPER easy to use. It's simple to pop in a dirty bottle into the machine, and before you know it, your bottles are sparkling clean and ready for reuse. The block itself is also very compact and lightweight, making it easy to store in my nursing bag or diaper bag.
But what really sets this product apart is its ability to get out even the toughest stains and residue. I've tried other bottle washing methods before, but nothing compares to the effectiveness of this block. My bottles come out looking like new every time!
The best part? The Momcozy Official Washing Block is affordable and makes a great investment for any breastfeeding mom. Trust me when I say that you won't regret buying this product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 27, 2025
★★★★★ 5
Amazing
The Momcozy Bottle Washer Tablets have been such a great addition to our daily routine. As a busy parent, anything that makes cleaning bottles easier is a huge win, and these tablets really do the job well.
They dissolve quickly and help remove milk residue and buildup from bottles, pump parts, and other baby feeding accessories. After using them, everything comes out clean, fresh, and residue-free, which gives me peace of mind knowing my baby’s items are properly sanitized.
I also love how convenient they are. Instead of measuring or dealing with messy liquids, you simply drop a tablet in and let it work. It saves time and makes the whole process much simpler, especially during those busy days and late-night bottle cleanups.
Another plus is that they seem gentle but effective, which is important when cleaning items used for babies.
Overall, these tablets are easy to use, effective, and a real time saver. I would definitely recommend them to other parents looking for a simple and reliable way to keep baby bottles and feeding supplies clean. I will absolutely be purchasing them again! ✨
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2026
recommand products
Godo, Bandit Warlord (Oversized) [Commander's Arsenal Oversized]
4400.00
Azorius Guild Token [Dragon's Maze Tokens]
1600.00
Black Lotus (9 of 9) (Ultra PRO Puzzle Quest) [Media Promos]
96000.00
Pirate // Treasure Double-Sided Token [Friday Night Magic 2017]
750.00
Domri, Anarch of Bolas (Japanese Alternate Art) [War of the Spark Promos]
24250.00