SKU: 98799969860

SFTPD His Tag Protein, Mouse

$182.70 $203.00
Save 10%
No.2 Bestseller on watersyst.com >

Pay in installments of $50.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SFTPD His Tag Protein, MouseProduct Specification Species Mouse Antigen SFTPD Synonyms SP D, PSP D, SFTP4, COLEC7 Accession P50404 Amino Acid Sequence Ala20 Phe374, with C terminal 8*His

Product Specification


Species Mouse
Antigen SFTPD
Synonyms SP-D, PSP-D, SFTP4, COLEC7
Accession P50404
Amino Acid Sequence

Ala20-Phe374, with C-terminal 8*His AEMKSLSQRSVPNTCTLVMCSPTENGLPGRDGRDGREGPRGEKGDPGLPGPMGLSGLQGPTGPVGPKGENGSAGEPGPKGERGLSGPPGLPGIPGPAGKEGPSGKQGNIGPQGKPGPKGEAGPKGEVGAPGMQGSTGAKGSTGPKGERGAPGVQGAPGNAGAAGPAGPAGPQGAPGSRGPPGLKGDRGVPGDRGIKGESGLPDSAALRQQMEALKGKLQRLEVAFSHYQKAALFPDGRSVGDKIFRTADSEKPFEDAQEMCKQAGGQLASPRSATENAAIQQLITAHNKAAFLSMTDVGTEGKFTYPTGEPLVYSNWAPGEPNNNGGAENCVEIFTNGQWNDKACGEQRLVICEFGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 43-50kDa
Purity ＞95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Kuroki Y, Voelker DR. Pulmonary surfactant proteins. J Biol Chem. 1994;269:25943–25946.
2. Sano H, Kuroki Y. The lung collectins, SP-A and SP-D, modulate pulmonary innate immunity. Mol Immunol. 2005; 42:279–287.
3. Hu F, Ding G, Zhang Z, Gatto LA, Hawgood S, Poulain FR, et al. Innate immunity of surfactant proteins A and D in urinary tract infection with uropathogenic escherichia coli. J Innate Immun. 2015; 22:9–20.
4. Liu Z, Shi Q, Liu J, Abdel-Razek O, Xu Y, Cooney RN, et al. Innate immune molecule surfactant protein d attenuates sepsis-induced acute pancreatic injury through modulating apoptosis and NF-κB-mediated Inflammation. Sci Rep. 2015; 5:17798.
5. Stahlman MT, Gray ME, Hull WM, Whitsett JA. Immunolocalization of surfactant protein-D (SP-D) in human fetal, newborn, and adult tissues. J Histochem Cytochem. 2002;50:651–660.

Background

Surfactant Protein D (SP-D, gene name: SFTPD) is a pattern recognition molecule belonging to the family of collections expressed in multiple human organ systems, including the lungs. SFTPD is located at the genomic position 10q22.2‐23.1. In addition to the respiratory system, SFTPD is also expressed in several other tissues/organs, such as the brain, pancreas, kidney, gut, endothelium, and reproductive system. SFTPD was initially identified to be expressed and secreted in lung alveolar epithelial type II cells and plays a crucial role in protecting the lung from inhaled microorganisms, organic antigens, and toxins by recruiting the innate immune system and consequently regulating inflammatory activities. SFTPD is a critical component of the innate immune system intrinsically linked to energy metabolism. SFTPD plays an important role in the innate immune system by binding bacteria, viruses, fungi, and parasites for clearance via opsonization in phagocytes, as well as aiding in the removal of allergens.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 98799969860

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
D. Hilbert
Chelsea, US
★★★★★ 5
The best
Style: 3.38 Fl Oz (Non SPF)
I’ve been using the La Roche-Posay Toleriane Double Repair Face Moisturizer for a few weeks now, and it’s honestly one of the best daily moisturizers I’ve tried—especially for sensitive skin. First thing I noticed is how lightweight it feels. It absorbs quickly and doesn’t leave that greasy or heavy film that a lot of “hydrating” lotions do. My skin feels instantly softer, but not suffocated. It layers really well under makeup too—no pilling or weird texture. What really stands out is how balanced my skin has been since using it. I tend to get dry patches but also occasional breakouts, and this somehow helps with both. It hydrates without clogging pores, and I’ve noticed less redness overall. The fact that it contains ceramides and niacinamide is a huge plus if you’re trying to repair your skin barrier. It’s also fragrance-free, which I personally look for because anything scented tends to irritate my skin. The only small downside is the price point compared to drugstore moisturizers, but honestly, a little goes a long way and the quality makes it worth it. Overall, I’d definitely recommend this if you have sensitive, combination, or dry skin and want something simple but effective. It’s become a staple in my routine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
S
Verified Purchase
SK
Carnegie, US
★★★★★ 5
Great daily lotion
Style: 3.38 Fl Oz (Non SPF)
Great daily lotion. I love that it is light and fragrance free. It is perfect for day use. I have dry skin and sometimes it is not enough to use by itself. I mostly use it during the day as a base for sunscreen but it feels really good on the face and does not leave my face feeling greasy. The ingredients are really good and the value for money is great. I love LRP products and this is so easy to use.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
E
Verified Purchase
Erika Ponte
Pawtucket, US
★★★★★ 5
✨ My New Favorite Face Cream for Hydrated & Glowing Skin ✨
Style: 3.38 Fl Oz (Non SPF)
“I’ve been using this La Roche-Posay cream for a few days now and I absolutely love it 😍💧 My skin feels super hydrated, soft, and has a healthy glow without any greasy residue. Plus, it’s perfect for sensitive skin because it feels light and soothing. My face feels so much fresher and more cared for ✨ I would definitely buy it again
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
K
Verified Purchase
Krystina Mercer
Draper, US
★★★★★ 4
Moisturizing & repairs skin barrier, but does pill.
Style: 3.38 Fl Oz (Non SPF)
Given myself a couple weeks of consistent use before giving a review. There are a lot of pros to this product which include: moisturizing and stays moisturized all day, made my PIE marks (post acne marks) fade a lot faster. Repairs my skin barrier, especially while using tretinoin nightly, not too thick but thick enough to keep my face hydrated. It does not have a smell. The cons are: slight burn for about 15 seconds but disappears, it pills if I apply too much. It does pill less if I pat it on my face versus rubbing; it does not pill when I apply liquid foundation. I just have to let it dry for 15-20 mins before applying makeup. I found the pros to overpower the cons and will continue to use this product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
G
Verified Purchase
Gloria Wright
Boise, US
★★★★★ 5
Will buy again!
Style: 3.38 Fl Oz (Non SPF)
This is a very nice product. For the size it seems a bit expensive, but a little goes a long way and it may be a better value than I initially thought. My skin does look better, so it is doing it's job! I like the texture of it. It is fairly light, not oily, absorbs quickly into the skin, which I like. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026

recommand products

Joy Blush Pink Bone Inlay Geometric 3 Drawer Console
1079.40
Rodenstock R7133
103.50
Police SPL890
137.00
Police VPLP15
128.00
Timberland TB50048
111.00