SKU: 97802236512

Monkeypox virus L1R, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 9 - Jul 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Monkeypox virus L1R, His TagProduct Specification Species MPXV Synonyms Monkeypox,Mpox Accession Q8V4Z7 Amino Acid Sequence MDHNQYLLTMFFADDDSFFKYFASQDDESSLSDILQITQYLDFLLLLLIQSKNKLEAVGHCYESLSEEYRQLTKFTDSQDFKKLFNKVPIVTDGRVKLNKGYLFDFVISLMRFKKESALATTAIDPVRYIDPRRDIAFSNVMDILKSNKVEQGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight 19. 4 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution

Product Specification


Species MPXV
Synonyms Monkeypox,Mpox
Accession Q8V4Z7
Amino Acid Sequence

MDHNQYLLTMFFADDDSFFKYFASQDDESSLSDILQITQYLDFLLLLLIQSKNKLEAVGHCYESLSEEYRQLTKFTDSQDFKKLFNKVPIVTDGRVKLNKGYLFDFVISLMRFKKESALATTAIDPVRYIDPRRDIAFSNVMDILKSNKVEQGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight 19.4 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.

·1 month, 2 to 8 °C under sterile conditions after reconstitution.

·Please avoid repeated freeze-thaw cycles.

Background

L1R is highly homologous to vaccinia virus protein J1R. Vaccinia virus contains a conserved J1R open reading frame that encodes a late protein of 17.8 kDa. The 18-kDa J1R protein is associated mainly with the membrane fraction of intracellular mature virus particles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97802236512

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 1346 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
Believer247
New York, US
★★★★★ 3
Mediocre salt and pepper grinders
Color: Upgrade Silver, Size: Rechargeable
Pros: They do work, and they are rechargeable. Cons: the motors run really slow, capacity is low, The charging tray you have to empty frequentlyto reduce buildup underneath the salt and pepper grinders.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2026
B
Verified Purchase
Bibi
Lexington, US
★★★★★ 5
Sleek and classy
Color: Upgrade Silver, Size: Rechargeable
I love that these are rechargeable
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
W
Verified Purchase
Walnut Creek Lady
Louisville, US
★★★★★ 5
Excellent Pepper Grinder
Color: Upgrade Black, Size: Rechargeable
I've had several pepper grinders over the years, and none was as easy and smooth to use as this one. It fills easily, and it grinds evenly and smoothly with a gentle press of the button. I am glad there are two, just in case one does give out, I will have the other to use, as I am not interested in grinding salt. It runs so effortlessly that you have to be a little careful when picking it up that you do not accidentally engage the button before you want the pepper to come out. I love it, and came back here after using it for two months just to let you know.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
G
Verified Purchase
GY
Waukegan, US
★★★★★ 5
Greatest Kitchen Item I've Bought in Years
Color: Upgrade Black, Size: Rechargeable
These grinders are awesome. No more tedious grinding, or endless shaking! I love the adjustable grind levels (I like mine fairly coarse), and these hold a charge for a long time - months. My friends are super impressed when they visit, and will probably be buying these too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
A
Verified Purchase
Amazon Customer
Fort Morgan, US
★★★★★ 5
Fast and efficient!
Color: Upgrade Black, Size: Rechargeable
These are a very nice set. Our other pair started grinding the salt and pepper as soon as you flipped it over and made a mess. This set here you have to push the button first. Also it is faster at grinding. Recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026

recommand products