SKU: 10720946152

Human CD45, His tag

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD45, His tagProduct Specification Species Human Synonyms Leukocyte common antigen (L CA), T200, CD45 Accession P08575 Amino Acid Sequence Protein sequence (P08575, Gln26 Gly100, with C 10*His) QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 9. 5 kDa Observed MW: 55 72 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance Lyophilized

Product Specification


Species Human
Synonyms Leukocyte common antigen (L-CA), T200, CD45
Accession P08575
Amino Acid Sequence

Protein sequence (P08575, Gln26-Gly100, with C-10*His) QSPTPSPTGLTTAKMPSVPLSSDPLPTHTTAFSPASTFERENDFSETTTSLSPDNTSTQVSPDSLDNASAFNTTGGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 9.5 kDa Observed MW: 55-72 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD45 is a member of the protein tyrosine phosphatase (PTP) family. CD45 contains an extracellular domain, a single transmembrane segment, and two tandem intracytoplasmic catalytic domains, and thus belongs to the receptor type PTP family. CD45 is a type I transmembrane protein that is present in various isoforms on all differentiated hematopoietic cells (except erythrocytes and plasma cells). CD45 has been shown to be an essential regulator of T- and B-cell antigen receptor signalling. It functions through either direct interaction with components of the antigen receptor complexes via its extracellular domain (a form of co-stimulation), or by activating various Src family kinases required for the antigen receptor signaling via its cytoplasmic domain. CD45 also suppresses JAK kinases, and so functions as a negative regulator of cytokine receptor signaling. CD45 does not colocalize with lipid rafts on murine and human non-transformed hematopoietic cells, but CD45 positioning within lipid rafts is modified during their oncogenic transformation to acute myeloid leukemia. CD45 colocalizes with lipid rafts on AML cells, which contributes to elevated GM-CSF signal intensity involved in proliferation of leukemic cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 10720946152

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
V
Verified Purchase
Veller
Cuba, US
★★★★★ 5
Impressive
Scent: Lavender, Size: 32 Fl Oz (Pack of 1)
Very nice lavender scent. It smells like real lavender. It provides lasting moisture. Perfect after a bath.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
A
Verified Purchase
Alan
Fort Morgan, US
★★★★★ 5
Eczema
Puriya 5-in-1 Eczema Cream is worth every penny. While it may be priced slightly higher than some other creams, the quality and effectiveness make it a great value—especially since a little goes a long way! After trying countless products that either didn’t work or needed constant reapplication, this cream truly stands out for its long-lasting hydration and soothing effect. The scent is subtle and pleasant, which is perfect for sensitive skin. Unlike some lotions that have overpowering fragrances, this has a mild, natural aroma that doesn't linger or irritate. Most importantly, its effectiveness is unmatched! From the first use, the intense itching and irritation noticeably calmed down, and with regular application, I’ve seen a huge improvement in skin texture and hydration. It absorbs quickly, without feeling greasy, and provides relief for hours. Whether you're dealing with eczema, dry patches, or general skin discomfort, this cream delivers real results.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2025
J
Verified Purchase
Julie Moeser
Omaha, US
★★★★★ 5
It works very well.
I recommend this cream for eczema. I had several spots on my body so I would slather it on and with in 1 month the spots on my body were gone. BUT the spots on my scalp have not gone as it is hard to put this on your hair/ scalp every time it itches. So this has been an ongoing problem but it does soothe the skin that is flaring up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026
R
Verified Purchase
Rikki M
Bozeman, US
★★★★★ 5
Best Cream!!
Love this stuff! I got this because menopause was killing my skin. It was awful! Itchy, red and dry. I couldn't sleep it was so bad. I found this, and it's literally the only thing that actually helped. I went through my first jar quickly, no you don't need much, but my rash was all over my arms, neck and chest. After my second jar and using it a few times a day, my rash is gone! Some people may not like the smell, but I think it's actually nice. It's not greasy, and I don't feel gross after putting it on. I hate greasy creams. On my third jar now! This one is lasting much longer since I don't need it as much.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
A
Verified Purchase
AW
Lake Worth, US
★★★★★ 4
Good Relief, But a Little Pricey
I don’t usually write reviews, but I felt like this cream deserved one. I’ve tried so many products for dry, itchy eczema patches, and most either felt greasy, burned when applied, or just didn’t do much. Puriya has been such a refreshing change. The texture is smooth, it absorbs quickly without leaving that sticky feeling, and within a couple of days my skin felt calmer and the redness started to fade. What I really like is how versatile it is. I’ve used it on flare-ups, random dry spots, and even my hands when they get irritated in the summer. It feels gentle but still effective, and I don’t need to use a ton for it to work. The only reason I didn’t give it 5 stars is the price. It’s a little on the higher side for the amount you get. I also find myself reapplying a bit more often than I’d like. But overall, it’s one of the better creams I’ve tried, and I’ll definitely keep using it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 13, 2025

recommand products