SKU: 91914050242

Human CD36, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD36, His tagProduct Specification Species Human Synonyms Fatty acid translocase (FAT), Glycoprotein IIIb (GPIIIB), Leukocyte differentiation antigen CD36, PAS IV, PAS 4, Platelet collagen receptor, Platelet glycoprotein IV (GPIV), Thrombospondin receptor, GP3B, GP4 Accession P16671 Amino Acid Sequence Protein sequence (P16671, Gly30 Asn439, with C 10*His)

Product Specification


Species Human
Synonyms Fatty acid translocase (FAT), Glycoprotein IIIb (GPIIIB), Leukocyte differentiation antigen CD36, PAS IV, PAS-4, Platelet collagen receptor, Platelet glycoprotein IV (GPIV), Thrombospondin receptor, GP3B, GP4
Accession P16671
Amino Acid Sequence

Protein sequence (P16671, Gly30-Asn439, with C-10*His) GDLLIQKTIKKQVVLEEGTIAFKNWVKTGTEVYRQFWIFDVQNPQEVMMNSSNIQVKQRGPYTYRVRFLAKENVTQDAEDNTVSFLQPNGAIFEPSLSVGTEADNFTVLNLAVAAASHIYQNQFVQMILNSLINKSKSSMFQVRTLRELLWGYRDPFLSLVPYPVTTTVGLFYPYNNTADGVYKVFNGKDNISKVAIIDTYKGKRNLSYWESHCDMINGTDAASFPPFVEKSQVLQFFSSDICRSIYAVFESDVNLKGIPVYRFVLPSKAFASPVENPDNYCFCTEKIISKNCTSYGVLDISKCKEGRPVYISLPHFLYASPDVSEPIDGLNPNEEEHRTYLDIEPITGFTLQFAKRLQVNLLVKPSEKIQVLKNLKRNYIVPILWLNETGTIGDEKANMFRSQVTGKINGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 48.3 kDa Observed MW: 72-95 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD36 (cluster of differentiation 36), also known as platelet glycoprotein 4, fatty acid translocase (FAT), scavenger receptor class B member 3 (SCARB3), and glycoproteins 88 (GP88), IIIb (GPIIIB), or IV (GPIV) is a protein that in humans is encoded by the CD36 gene. The CD36 antigen is an integral membrane protein found on the surface of many cell types in vertebrate animals. It imports fatty acids inside cells and is a member of the class B scavenger receptor family of cell surface proteins. CD36 binds many ligands including collagen, thrombospondin, erythrocytes parasitized with Plasmodium falciparum, oxidized low density lipoprotein, native lipoproteins, oxidized phospholipids, and long-chain fatty acids. Work in genetically modified rodents suggest a role for CD36 in fatty acid metabolism, heart disease, taste, and dietary fat processing in the intestine. It may be involved in glucose intolerance, atherosclerosis, arterial hypertension, diabetes, cardiomyopathy, Alzheimer's disease and various cancers, mostly of epithelial origin (breast, prostate, ovary, and colon) and also for hepatic carcinoma and gliomas.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 91914050242

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Ryan
San Leandro, US
★★★★★ 4
Great product that makes edging very fast
Size: 8" Edger New
Edging was quite a job because I had to do it with a hand tool. I have quite a few Greenwork tools, so I decided to purchase the edger. It works great and I am in general happy with it. The three downsides for me are that tool is quite heavy when it also has the battery in it, that the metal blade decreases in size rapidly because of the friction when edging near concrete, and that the wheel is in such a position that I have to bend substantially while the blade does not edge deep enough so that I have to lean the tool on the metal strip at the bottom of the tool.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 17, 2025
R
Verified Purchase
rebecca hansen
Port Orchard, US
★★★★★ 5
Very pleased
Size: 8" Edger New
Works well and gives a nice clean line. I am able to take care of the overgrown edges very fast.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026
C
Verified Purchase
Charles Sebastian
Lake Worth, US
★★★★★ 5
Plenty of power. Easy to use.
Size: 8" Edger New
I was amazed at the power of this edger. Due to health issues we couldn’t give our lawn adequate attention. It hadn’t been edged in over a year. This edger cut thru the heavy overgrown grass. Maintaining the edging now is a breeze. It uses the same 80 volt battery as my blower👍. The only negative is there is no edge guide, but once I got used to it, it’s not really needed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
B
Verified Purchase
Bill
Massapequa, US
★★★★★ 5
Great product, well made, would buy again!
Size: 8" Edger New
Great product, well made, would buy again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026
K
Verified Purchase
KimberlyY
Lake Worth, US
★★★★★ 5
Uses same battery as the rest of my equipment
Size: 8" Edger New
Since I already have and like the Greenworks mower, string trimmer and blower it only made sense to get the edger. Even better that I didn’t need to buy more batteries. I tried another name brand electric edger and returned it for not holding a charge. This one works great! There’s charge left in the battery after everything has been edged. I was concerned how easy it would be to control but fell in love with it first time I used it. To use just pop the battery in, flip the thumb lever, squeeze and edge. Not as noisy as gas powered equipment and no cords to pull. Feels sturdy in my hands and a good weight that’s enough to not pop up if it hits something but not too much to be heavy to carry back to the shed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 29, 2025

recommand products