SKU: 13524849629

CD30/TNFRSF8 His Tag Protein, Human

Sale price$187.20 Regular price$208.00
Save 10%

Pay in installments of $52.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD30/TNFRSF8 His Tag Protein, HumanProduct Specification Species Human Synonyms TNFRSF8, CD30, D1S166E, Ki 1 Accession P28908 Amino Acid Sequence Phe19 Lys379, with C terminal 8* His

Product Specification


Species Human
Synonyms TNFRSF8, CD30, D1S166E, Ki-1
Accession P28908
Amino Acid Sequence

Phe19-Lys379, with C-terminal 8* His FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGKGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

72-89kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Feghali-Bostwick C A. et al. (2008) Autoantibodies in patients with chronic obstructive pulmonary disease. American Journal of Respiratory and Critical Care Medicine. 177(2): 156-163.

2、Wang G N. et al. (2017) Prognostic significance of CD30 expression in nasal natural killer/T-cell lymphoma. Oncology Letters. 13(3): 1211-1215.

3、Horie R. et al. (1998) A novel domain in the CD30 cytoplasmic tail mediates NFκB activation. International Immunology. 10(2): 203-210.

4、Xu M L. et al. (2020) Practical approaches on CD30 detection and reporting in lymphoma diagnosis. Am J Surg Pathol. 44(2): 1-14.

Background

CD30, a member of the tumor necrosis factor receptor superfamily, also known as Ki-1, is a kind of type I transmembrane glycoprotein. The CD30 protein is composed of 595 amino acids, and the cytosolic and transmembrane region in the protein are composed of 188 amino acids and 24 amino acids, respectively. The extracellular region is the leading peptide of 18 amino acids, followed by 365 amino acids. CD30 is widely expressed in viral-infected lymphocytes and lymphoma cells and activated T cells. Moreover, CD30 is also expressed in alveolar macrophages, epidermal cells, activated NK cells, decidual cells, resting B cells, granulocytes, thymocytes, and medulla cells. The bind of CD30 and CD30L induces the production of cytokine, which promotes cell proliferation, differentiation, cell growth, stagnation, and death. Binding of CD30 with its receptor ligand activates TNF receptor-associated factor (TRAF)2 and TRAF5, initiating signal transduction pathways that can lead either to proliferation or apoptosis. CD30 induced apoptosis may lead to the self-regression seen in lymphomatoid papulosis lesions, whereas proliferation may result in anaplastic large-cell lymphoma (ALCL). CD30 ligation leads to nuclear factor-kappa B (NFκB) and/or mitogen-activated protein kinase (MAPK) pathways, ultimately leading to survival of neoplastic cells. CD30 can serve both as a diagnostic marker for lymphocyte malignancies and as a target for therapy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 13524849629

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nikki
San Leandro, US
★★★★★ 5
Skin feels so soft!
I actually love this stuff it makes my skin feel so smooth and soft after I use it! I don’t see a difference between the two they both work equally imo. Great if you’re in a budget and was great exfoliation!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
A
Verified Purchase
Alisa
West Palm Beach, US
★★★★★ 2
Not as good as the real thing
I was really hoping to get a less expensive alternative to Dr Melaxin’s version. This just isn’t cutting it - it totally is not as effective, so I’m tossing this and going back. This one just doesn’t pill up as effectively.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
I
Verified Purchase
I. Alexander
Port Orchard, US
★★★★★ 1
Not as effective as original Dr. M
I bought this after reading several reviews that it is as effective as the original Dr. M. Having used both I can assert this product is NOT nearly as effective. I still had some of the original Dr. M. and did a half and half comparison and it was immediately clear. This exfoliate "pills" like the original but not nearly to the degree and when washed away the half I used the leftover Dr. M. was clean of dead skin and showed clear pores. The other half? Not so much. I'll be going back to the original.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026
K
Verified Purchase
Karly
Draper, US
★★★★★ 4
Good stuff
Not the actual Dr. Melaxin but it still works!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
L
Verified Purchase
Lex
New York, US
★★★★★ 5
Great sunscreen
Size: 2.82 Fl Oz (Pack of 1)
No white filmy cast. Soothing and easy to apply.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026

recommand products