SKU: 43406342702

LRP10 His Tag Protein, Mouse

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LRP10 His Tag Protein, MouseProduct Specification Species Mouse Synonyms LRP10, LRP9, MST087, MSTP087 Accession Q7TQH7 Amino Acid Sequence Arg18 Lys441, with C terminal 10* His

Product Specification


Species Mouse
Synonyms LRP10, LRP9, MST087, MSTP087
Accession Q7TQH7
Amino Acid Sequence Arg18-Lys441, with C-terminal 10* His RPDRITFPRSACEAPPAVLSEVQGTLQRPLGRDSRSSPANCTWVILGSKDQTVTVRFQKLHLACGSEHLILHSPLQPPISLCEAPSGPLQLPGGNVTITYSYAGARAPMGQGFLLTYSQDWLLCLQEEFQCLNHRCIPAAQRCDGIDACGDGSDEAGCSSDPFPNLNPAPAPTLACNLTLEDFYGVFSSPGYSHLASVSHPQSCLWLLDPHDGRRLAVRFTALDLSYGDAVHVYDGAGPPETPRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSSGRGFNATYHVRGYCLPWDRPCGLGSGLGASENLGERCYSEAQRCDGSWDCADGTDEEGCPGCPPGHFPCGAAGTPGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCTDGSDEWDCSYALPRKGGGSGGGSHHHHHHHHHH
Expression System HEK293
Molecular Weight 56-61kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Jeong Y H. et al. (2010) The low-density lipoprotein receptor-related protein 10 is a negative regulator of the canonical Wnt/beta-catenin signaling pathway. Biochem Biophys Res Commun. 392(4): 495-499.

2、Beisiegel U. et al. (1991) Lipoprotein lipase enhances the binding of chylomicrons to low density lipoprotein receptor-related protein. Proc Natl Acad Sci U S A. 88(19): 8342-8346.

3、Strickland D K. et al. (1990) Sequence identity between the alpha 2-macroglobulin receptor and low density lipoprotein receptor-related protein suggests that this molecule is a multifunctional receptor. J Biol Chem. 265(29): 17401-17404.

Background

Human LDLR-related protein 10 (LRP10, called LRP9 in mice) is a member of a new subfamily of LDLR that includes two other receptors, LRP3 and LRP12. This unique subfamily of LDLR is characterized by extracellular CUB domains and large cytoplasmic tails containing acidic dileucine (DXXLL) motifs. LRP10 is expressed in various tissues (including the brain), and is localized in the TGN and endosomes. It is reported that LRP10 is a functional amyloid precursor protein (APP) receptor involved in APP trafficking and processing. Some studies have suggested a role of LRP10 in ligand trafficking between the trans-Golgi network, endosomes, and the plasma membrane. Recently, LRP10 has been associated with PD, Parkinson's disease Dementia (PDD) and Dementia with Lewy Bodies (DLB) by linkage analysis and positional cloning in an Italian family with late-onset PD. Moreover, LRP10 variants have been found in individuals diagnosed with progressive supranuclear palsy and amyotrophic lateral sclerosis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 43406342702

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Julie Rucker
Grantham, US
★★★★★ 4
Not a simple plug and play. It does work though
Style: WF-4830, Set: DUAL TRAY (500 sheets)/FAX/ADF/PRINT/COPY/SCAN
Set up was not simple .. but I figured it out
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 2, 2026
R
Verified Purchase
Richard G.
Omaha, US
★★★★★ 5
Great for small office
Style: WF-4830, Set: DUAL TRAY (500 sheets)/FAX/ADF/PRINT/COPY/SCAN
Works good just I expected
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
W
Verified Purchase
William J Garrison
Carnegie, US
★★★★★ 5
Good value
Style: WF-4830, Set: DUAL TRAY (500 sheets)/FAX/ADF/PRINT/COPY/SCAN
Great color printer. Accepts multi types of paper and stock. Dual sided printer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2026
H
Verified Purchase
Hoffie51
San Leandro, US
★★★★★ 5
First Rate Office Printer.
Style: WF-4830, Set: DUAL TRAY (500 sheets)/FAX/ADF/PRINT/COPY/SCAN
This is the second Epson product that we have owned. The previous model was still working after 8 years of dependable service when we replaced it. We tried to move up to an Eco Tank model that we purchased locally. The unit would not connect to our wireless network, so we returned it to the store and purchased this model from Amazon. The overall quality of the output is just as good or even a little better than our old model. This unit is quite a bit faster that our old unit. The unit was also reduced by 34%, making an excellent buy. The jury is still out if it will be good in the ink usage department. Our old unit seemed to need a new cartridge every other week, I would purchased this model again,
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 4, 2026
L
Verified Purchase
LJ & AJ
Carnegie, US
★★★★★ 1
Love & Hate at the same time
Style: WF-4830, Set: DUAL TRAY (500 sheets)/FAX/ADF/PRINT/COPY/SCAN
I installed, connected to the internet, everything was smooth and the 1st day I printed doc, scanned, sent air etc etc etc, and it was working absolutely great. Next day started asking to perform updates, then it was disconnected to the air computer, I couldn't scan, I connected a cable directly and it didn't work either, becae a nightmare and as last resource, I had to scan through a usb device and then connect to the computer back and forth. Then next days, it was always for updates, downloading more date on my computer as well update the printer, it is like they are spying everything you do with a printer, I just want to use it to print/scan/copy documents or any other info, if it is working just find the 1st day, why these companies begin with harassing the buyer with all these daily updates or connecting hundreds of things to make it work. It was much easier in the past, you just install the program of the printer with a CD and that was it! I had one of those printers before this one and it worked for 12 consecutive years with NO PROBLEMS whatsoever. And the last problem is that IS NOT WORKING AT ALL, I had to stored the printer computer and all my office equipment for 6 months and I plugged in everything and the printer asked for new cartridges, I took them out and they are still full of ink, my fingers completely colored & stained are witnesses & now it says use Epson Support code error 031006 ?!?!?!?!?! There is not a web/ph/any kind of information where do I need to go, I barely use the printer at all, it still has some of the protection plastic and it is already damaged. What a pain. Seriously they should at least add who or where we can ask for help. Now AGAIN buying a new printer because for sure EPSON IS NOT GOING TO HELP ME :((((
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2024

recommand products