SKU: 14169196824

NKp30/CD337 Fc Chimera Protein, Human

Sale price$198.00 Regular price$220.00
Save 10%

Pay in installments of $55.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 9 - Aug 14

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

NKp30/CD337 Fc Chimera Protein, HumanProduct Specification Species Human Accession O14931 Amino Acid Sequence Leu19 Thr138, with C terminal human IgG1 Fc

Product Specification


Species Human
Accession O14931
Amino Acid Sequence Leu19-Thr138, with C-terminal human IgG1 Fc LWVSQPPEIRTLEGSSAFLPCSFNASQGRLAIGSVTWFRDEVVPGKEVRNGTPEFRGRLAPLASSRFLHDHQAELHIRDVRGHDASIYVCRVEVLGLGVGTGNGTRLVVEKEHPQLGAGTIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Expression System HEK293
Molecular Weight 55-65 kDa(Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Natural killer protein 30 (NKp30; also known as natural cytotoxicity receptor 3, NCR3; or CD337) is an Ig-like activating receptor of NK cells regulating the cross talk between NK and dendritic cells. It is expressed on the surface of NK cells, recently-expanded γδT cells, activated CD8 cells, and innate lymphocytes. The extracellular part of NKp30 consists of a single N-terminal Ig-like domain, followed by a distinct 15 amino acids long stalk region proximal to the plasma membrane, which is important for receptor signaling. Further, three specific cellular ligands of NKp30 have been identified. NKp30 binds a member of B7 family, in particular B7 homolog 6 (B7-H6). Interaction of NCR3 with B7H6 leads to activation of NK cells and induces cytolysis of target cells resulting in apoptotic cell death. Another NKp30 cellular ligand, BAG-6 is recruited to the cell membrane and interacts with NKp30 in some tumor cells or under the stress conditions. The most recently discovered NKp30 ligand, galectin 3, expressed on the surface of some tumors, almost completely blocks NK cell cytotoxicity. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 14169196824

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 6 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Destiny Evans
Lowell, US
★★★★★ 5
Must have
Format: Hardcover
Great quality hard back book. I have purchased 4, one for each of my children and will eventually but 2 more. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
D
Verified Purchase
Donna K
Boise, US
★★★★★ 5
Makes a great graduation gift
Format: Hardcover
It's a classic! I bought it for my granddaughter's kindergarten graduation. I've asked her teacher to write a note in it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
C
Verified Purchase
chrissycf
Lowell, US
★★★★★ 5
Absolutely the best in the series so far!
Format: Kindle
I've been wanting to get Dean's book since we met him in The Deal, and let me tell you, this book did NOT disappoint! Dean is the playboy of the hockey team, he doesn't do relationships, and he just takes life as it goes. Allie is Hannah's best friend and roommate, and is a relationship type of girl. When she realizes her and her boyfriend are moving in separate directions and she can't do it anymore she breaks up with him. When she needs a place to hide out, Garrett offers up his house while they are away. She never expected that weekend to change everything for her. Dean and Allie definitely have amazing chemistry, but one night together doesn't change things for them, or does it? Dean can't get Allie out of his head, and Allie knows she can't do a casual hookup, but they can't seem to keep away from one another. I loved how Dean finally wore Allie down, and how Allie finally got to have someone with her that understood her and was just as adventurous as she was. I don't agree with how she didn't want anyone to know about them, but I think the way everyone found out was perfect for them. Dean and Allie's "relationship" is full of emotions, and you can slowly see this turning into something way more than what they thought it would be. Dean is amazing with Allie, he's supportive of her, he cares about her, and he's insanely jealous of anyone who dares look at her. Allie is loving how Dean makes her feel, and is also a huge supporter of his. For once in his life Dean opens up about himself and you can tell how nervous he was telling her about his ex, and everything involving the fall out of that situation. Their escapades are hilarious and sexy all at once. I loved watching them during Thanksgiving with Beau and his sister, where you can see that things definitely changed for them. I also adored their watching of the french soap opera, and all the little things they did together. Not only does this book have a true romance that you can't help but fall in love with these amazing characters, but there are some absolute laugh out loud moments. When Logan walks in on Dean and "Winston" I spit my drink out I was laughing so hard. Also the hilarious Twilight references on imprinting! There is also a very serious aspect to this book that had me in tears. My emotions were definitely all over the place while reading this book, and I must say I think I love Dean more than Garrett, and he's been sitting at the top of my BBF list for a long time! It's been a long time since I've read a book that I absolutely loved both of the main characters. I felt so connected to them, and their group of friends, that I thought I was right there with them experiencing their love, their laughs, and their heartbreak. This book definitely took me on one hell of a ride. I can't remember laughing so hard one moment, swooning and falling in love, and then balling my eyes out, only to have my heart put back together at the end. This is a beautifully written story and I could NOT put it down. I am definitely looking forward to Tuck's book, especially with the bomb-shell he dropped at the end of Dean's story! Even though this book can be read as a stand-alone, I highly suggest reading each of the previous two books in this series, so you can get a good feel of how much Dean has changed since we met him, as well as how the group dynamic works. Each one of the books are 5 star reads, and trust me, you will definitely fall in love with Garrett, Logan and Dean!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2016
I
Verified Purchase
Ivy D.
Phoenix, US
★★★★★ 4
The Good, The Bad and Everything In Between
Format: Kindle
Another excellent entry: The Off-Campus series is among the very, very best in new adult romance and there is little that isn’t done well in this entry. Dean DiLaurentis is charged with watching out for Allie, Hannah’s roomie, one weekend while everyone is gone for various reasons - with, of course, the obligatory threats to his penis if he were to touch Allie. She’s just gone through a painful breakup with her boyfriend from book one, since they’ve had a fairly tempestuous relationship, she needs some time away from her apartment, where he’s been trying to get her to change her mind. Of course, Allie and Dean are young, hot, single and there’s tequila. When you do the math, it’s fairly obvious that yes, Slot A goes into Tab B, and yes, romance happens. I love their banter, the humor throughout really establishes these characters and their friendships and makes the ride all the more enjoyable. Speaking of riding... Dean’s what I expected: Dean’s the manho who beats all the previous manhoes in this series. He makes no apologies and I loved that he didn’t. He’s intrigued with Allie but he isn’t in love from the moment he lays eyes on her. When he falls, though it’s hard and it’s clearly life-altering. His moments with his friend Beau when they discuss his issues with little Dean (I can’t stop giggling at that silliness) were priceless. He has a good journey towards adulthood, though I was saddened by the events that led to this character growth. It was the perfect (sad yet realistic) touch of bitter to make the sweet all the richer. Allie was a surprise: I’ll admit, this is mostly because I didn’t remember her. Allie isn’t a big part of the first book and what I did remember of her was a bit flaky. I loved getting to know her and seeing what made her tick and as with Ms. Kennedy’s previous heroines, there is more than meets the eye. She’s concerned about being slut-shamed by the prospect of no-strings sex, considering she’s only ever been in committed, long term relationships, so I love that she has to learn to accept that there’s nothing wrong with two consenting adults doing what they want to do, damn public opinion. I found it an interesting twist that the only person truly slut-shamed is Dean, by other men and women. Beats played out as I expected: If I have any issues with this is, while it is entertaining, charming, and funny, it also felt the same as the earlier books, which were also entertaining, charming and funny. When the quality is so high, that’s not a horrible thing, but I can’t help but struggle to keep each set of heroes and heroines separate in my mind. That said... I’m really intrigued by where this series is going next: The setup for the next book is markedly different and it has me really eager to see how Ms. Kennedy handles it. The heroine for the next book is NOT in the mold of the earlier women and the hero is a bit of a wild card, since he has been more on the periphery so far. I’m looking forward to seeing what they have to contribute to this universe. The Bottom Line This is an excellent new adult romance with likeable characters, funny banter, hot sex scenes and room for the ‘verse to grow. If you haven’t read Ms. Kennedy’s series, I highly recommend it. **ARC provided by author for review**
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2016
I
Verified Purchase
IslandDeb
Alexandria, US
★★★★★ 5
Ms. Kennedy Scores Again!
Format: Kindle
I am absolutely addicted to Elle Kennedy’s Off-Campus series. When I picked up The Deal last year I had no idea what to expect. I love her Navy SEAL series but a New Adult? I have to say, I fell so hard for that book it was ridiculous. Don’t tell anyone but I think I might even love this series more. Ack! I’m an adult. I’ve been out of college for more years than these characters have been alive! What’s wrong with me? What’s wrong with me is I’m a sucker for young love stories that have substance, well-developed characters, witty dialogue, and just enough angst to make it interesting without making me want to kill myself. And this is exactly what we get with Off-Campus. It’s not a given that each book in a series will top the last, or even equal its predecessors, but Ms. Kennedy has blown that theory out of the water. The Deal, The Mistake, and now The Score are all deliciously entertaining. I can’t say I love one more than the other because they are all unique. Each book focuses on one of four members of Briar University’s hockey team, all roommates in what I imagine in my head to be a large, rambling off-campus house. These guys are hardcore athletes, so of course, they’re gorgeous, sculpted of yummy muscles, confident, and can pretty much snap their fingers and the girls come running. But under those pretty exteriors and horndog antics lie endearing personalities. The thing I love most about the four guys sharing the house is they all have each other’s backs no matter what the circumstances. When it’s time to man up, be mature, and offer advice they excel at it. I love these guys. They’re also hilarious as hell. The Score is book 3, featuring self-professed man-whore Dean Di Laurentis and Allie Hayes, Hannah’s best friend (from book 1, The Deal) . These two couldn’t be more different. According to The Life of Dean, there are no repeat performances with girls. Ever. He’s not remotely interested in anything that involves the dirty word relationship. Allie, on the other hand, has dated the same guy for four years. Granted, they’ve broken up four times but this time, it’s for real. She’s even high tailed it out of the dorm she shares with Hannah and is hiding out at the guys’ house for the weekend. The couples are out of town, which leaves only Dean at home. Allie can surely smack down on his ridiculous flirting. But after some well-deserved tequila shots and a joint or maybe two, things get blurry and… "The memories come crashing back in vivid Technicolor. The terrible movie. The tequila shots. The… rest. I slept with Dean last night. Twice. My heart beats faster as I stare up at the ceiling. I’m in Dean’s room. There’s an empty condom wrapper on the end table. And… yep, I’m naked." What surprises Allie, even more, is that she seems to recall enjoying herself. A Lot. She’s got a kinky streak that her ex wasn’t on board with but Dean…wow. Regardless, it was beyond wrong and Hannah will kill her if she finds out, so Dean and Allie make a pact to keep it between them. Only problem is, Dean can’t stop thinking about Allie. It surprises the crap out of him because this is certainly a first but he needs, at least, one more taste. "After last night’s performance, Allie Hayes proved that she’s fully capable of leaving her mark on a man. Jesus. That girl can f***. Damn, and now my dick is semi-hard. It’s been doing that all day, chubbing out every time I think about Allie." Likewise, Allie can’t stop thinking about Dean. When Dean begs for more, she’s shocked. Maybe what she needs is indeed a fling. She may be a card-carrying member of the Team Boyfriend, but it hasn’t done her any favors in the last few years. A change might be good. But can she handle it? Allie and Dean are hilarious together. She isn’t the starry-eyed coed type he’s used to. She doesn’t say How high? when he says Jump. Their verbal sparring is exquisite! It’s not only entertaining, it’s also revealing. The more she treats him with nonchalance the more he falls for her. She’s not being a tease. She’s being realistic. Dean isn’t a long term keeper. He’s rich, spoiled, and gets what he wants. He’s only hanging around because she isn’t begging for his attention. Besides, she’s spent four years as a drama major, she’ll be graduating soon, and needs to focus on her acting career. But Dean is relentless, being all adorable and sexy, watching French soap operas with her and generally making her forget about her ex. Plus, Dean is just so damn HOT it’s irresistible. Dean is on a fast track to win over Allie. He can’t explain this all-consuming fascination and need and he doesn’t care. What little Dean wants, big Dean does his best to procure. Allie might consider this thing between them merely a fling but that’s not how it’s going down if he can help it. She makes him want to be a better man and, I must admit the more we learn about Dean, the harder I fell in love with him. He’s put on a good act for a long time; a Richie Rich man-whore who skates by on his charm and looks when in fact, he’s extremely intelligent, caring, and kind. Ms. Kennedy has once again given us another exceptional story that is not only fun, witty, and chock full of sexy chemistry. Unexpected and shocking surprises deepen the tension and pull at the heartstrings yet are by no means superfluous. The writing is beautiful, tight, fast-paced, and so entertaining I didn’t want it to end.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 16, 2016

recommand products