SKU: 14263026824

Galectin-9 His Tag Protein, Human

Sale price$288.90 Regular price$321.00
Save 10%

Pay in installments of $80.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Galectin-9 His Tag Protein, HumanProduct Specification Species Human Antigen Galectin 9 Synonyms Gal 9, Ecalectin, Tumor antigen HOM HD 21 Accession O00182 2 Amino Acid Sequence Ala2 Thr323, with N terminal 8* His

Product Specification


Species Human
Antigen Galectin-9
Synonyms Gal-9, Ecalectin, Tumor antigen HOM-HD-21
Accession O00182-2
Amino Acid Sequence

Ala2-Thr323, with N-terminal 8* His

HHHHHHHHAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Expression System HEK293
Molecular Weight

47-55kDa (Reducing)

Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Iwasaki-Hozumi H., Chagan-Yasutan H., Ashino Y., Hattori T. Blood Levelsof Galectin-9, an Immuno-Regulating Molecule, Reflect the Severity for theAcute and Chronic Infectious Diseases. Biomolecules. 2021;11:430.

2.Nishi N., Itoh A., Fujiyama A., Yoshida N., Araya S.-i., Hirashima M.,Shoji H., Nakamura T. Development of highly stable galectins: Truncation of thelinker peptide confers protease-resistance on tandem-repeat type galectins.FEBS Lett. 2005;579:2058–2064.

3.Oomizu S., Arikawa T., Niki T., Kadowaki T., Ueno M., Nishi N., Yamauchi A., HirashimaM. Galectin-9 suppresses Th17 cell development in an IL-2-dependent butTim-3-independent manner. Clin. Immunol. 2012;143:51–58. d

4.Bozorgmehr N., Mashhouri S., Perez Rosero E., Xu L., Shahbaz S., Sligl W.,Osman M., Kutsogiannis D.J., MacIntyre E., O’Neil C.R., et al. Galectin-9, aPlayer in Cytokine Release Syndrome and a Surrogate Diagnostic Biomarker inSARS-CoV-2 Infection. mBio. 2021;12:e00384-21.


Background

Galectin-9 is a β-galactoside binding lectin known for its immunomodulatory role in various microbial infections. Gal-9 is expressed in all organ systems and localized in the nucleus, cell surface, cytoplasm and the extracellular matrix. Gal-9 structurally consists of two homologous carbohydrate-recognition domains at the N- and C-terminus (NCRD and CCRD, respectively) linked by a linker peptide that is highly susceptible to proteolysis. It mediates host-pathogen interactions and regulates cell signalling via binding to its receptors. Gal-9 is involved in many physiological functions such as cell growth, differentiation, adhesion, communication and death. Gal-9 is a molecule that positively and negatively adjusts immune systems as both a contributing factor in cytokine storm and an immunosuppressive molecule inducing, for instance, T-cell exhaustion and apoptosis.


Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 14263026824

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Pan8ita
Alexandria, US
★★★★★ 5
EUFY 11S
Size: 2+8 pack
Used to replace the ones for my EUFY 11S vacuum. They fit just like the ones and got my vacuum back to cleaning really good. Didn’t realize how loud my vacuum had become until I replaced these parts.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2025
A
Verified Purchase
Armeeda
Lowell, US
★★★★★ 5
Get this!
Size: 3+12+12+2+1 pack
Very nice pack of essentials for my robot.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2026
A
Verified Purchase
Alex
West Palm Beach, US
★★★★★ 5
Side brush screw PSA 🤪
Size: Eufy B-18Packs
Reviewing parts for Eufy L60 Review posted for some PSA When you get the brush replacement this kit comes with a tiny screw driver DO NOT USE THAT TINY SCREWDRIVER TO UNDO YOUR SIDE BRUSH IT WILL STRIP THE OEM SCREW AND MAKE IT USELESS. the screw driver included fits the screws that are about 2 mil wide the side brush screw is different. Grab a regular screw driver to undo a side brush. The main rolling brush cover is different but the rubber part still hits the floor at proper height so I don’t see a big issue there. When replacing the filter the filter cover was a little snug but I don’t see a big problem there just be aware to close the cover all the way but be careful not to push too hard so the plastic clips don’t break on the cover. Don’t forget to wipe down all the seals when installing the filter to maintain the seal integrity to keep the suction at top intensity. The dust bags seemed to be cut out with a stencil which gave the cardboard a better appearance than the oem cut out dust bags so that was interesting, dimensions were identical when comparing so I don’t anticipate any issues! Over all I’m glad we have cheaper alternative replacement parts that can be used so thank you! ❤️
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 30, 2025
A
Verified Purchase
Amazon Customer
Alexandria, US
★★★★★ 5
Great parts replacement kit for Eufy!
Size: Eufy B-18Packs, Size: Eufy B-18Packs
This kit has made it nice keeping up with our Eufy robot vacuum. All parts were free of defect and fit as it should. Instead of replacing individual piece by piece, I now just change all of the replacement parts at one time and it’s good to go for a while! Great value. Great quality. Will definitely be buying this kit again!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
T
Verified Purchase
Terry Jeglum
Fort Morgan, US
★★★★★ 5
Replacement quality is outstanding
Size: Eufy A-21Packs
Great value. Plug and play. Worked as designed
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026

recommand products