Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 7 - Jul 12
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP1 His Tag, HumanProduct Specification Species Human Synonyms LFABP Accession P07148 Amino Acid Sequence Met1 Ile127, with N terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAG E& RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder
Product Specification
| Species | Human |
| Synonyms | LFABP |
| Accession | P07148 |
| Amino Acid Sequence | Met1-Ile127, with N-terminal 8*His MHHHHHHHHMSFSGKYQLQSQENFEAFMKAIGLPEELIQKGKDIKGVSEIVQNGKHFKFTITAGSKVIQNEFTVGEECELETMTGEKVKTVVQLEGDNKLVTTFKNIKSVTELNGDIITNTMTLGDIVFKRISKRI |
| Expression System | E.coli |
| Molecular Weight | 16kDa (Reducing) |
| Purity | ＞95% by SDS-PAG E& RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
FABP1 (LFABP) has been initially characterised in the liver (thus its name) but is also expressed in small intestine (duodenum and jejunum). FABP1 appears to be the most promiscuous FABP as it was reported to bind a variety of small molecules in addition to fatty acids including bile acids, lysophosphatidic acid, prostaglandins, fatty acyl-CoA, bilirubin and heme. FABP1 is a PPARα target gene. While some studies suggested that FABP1 might be involved in the delivery of ligands for PPARα activation in the nucleus, FABP1-deficient mice showed normal regulation of PPARα target genes regulation. FABP1 was reported to enhance apoB-lipoprotein secretion, which would suggest involvement of this protein in the delivery of fatty acids to the ER for esterification into lipoprotein-destined TG. Hepatic fatty acid oxidation is also diminished in fasted FABP1 knockout mice, which implies deficient transport of fatty acids to the oxidative pathway. Interestingly, no accumulation of intracellular TG accompanied attenuation of fatty acid oxidation even when the mice were challenged with a high-fat diet.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.6 ★★★★★
Based on 445 reviews
Sort
Product Reviews
★★★★★ 5
I can put it up by myself!!!
Size: 6 Person
So easy to use! Roomy and so well made!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
★★★★★ 1
No Good
Size: 6 Person
Brand new screen netting on door and windows had small holes thus allowing mosquitoes in. Unfortunately the return window passed but due to weather we just got to try it out last week. Also floor had pin holes first use which I think after several uses will develope bigger holes. Very thin material. Also came with no setup instructions but that was easy to figure out. Like the fast setup that’s it. I may have gotten someone else’s return ???
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
★★★★★ 5
Highly recommended
Size: 4 Person
This tent y’all!
We are avid campers, to the point that we have multiple tents for different adventures. We ordered this one for a quick weekend getaway and I was thoroughly impressed! We popped it up in seconds when it arrived. Sprayed it down with waterproofing spray, let it dry, and packed it back up with EASE! We have only used it once thus far, so I can’t account for the durability yet, but either way, for the price, I feel like this was definitely worth the purchase!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
★★★★★ 5
Excellent tent!
Size: 6 Person
Well-constructed tent, it sets up quickly, with no hassle, I turned the tent into my indoor/outdoor in graving station with a couple of space heaters, the tent heats up quickly where it's nice and warm, my boss didn't want me trashing the shop, so bought this tent to use as my workshop, I have no complaints with it. it also has a built-in pouch where you can put your phone or whatever items you want to put in there, which is a nice add on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 24, 2026
★★★★★ 5
Simple and not Drama claim process.
’ve had Asurion coverage for a couple of years and never needed to use it until recently, when my pool salt cell (less than two years old) stopped working. I had purchased it with an Asurion protection plan, so I contacted them to start a claim.
The process was simple and straightforward to follow. In the end, they honored the plan and covered the cost of my salt cell based on the value when I originally bought it. They issued me a gift card that I could use on Amazon for that amount.
While prices have gone up and a new cell now costs about $200 more, it was still definitely worth having the coverage. Overall, I’m satisfied with how the claim was handled.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2026
recommand products
Capto C3-PSC32-DDJNL22045-11
145.72
Grandy Oats Granola - Classic - Case Of 6 - 12 Oz.
45.21
Artisana Coconut Butter Organic - Case Of 6 - 8 Oz.
63.99
Andalou Naturals Comforting Face Lotion Hydrate And Condition - 3.1 Fl Oz.
16.64
Gomacro Bar - Organic - Bberry - Cashew Butter - Case Of 12 - 2.3 Oz
81.99