SKU: 1847941004

Human Plasminogen, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 3 - Aug 8

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Plasminogen, His tagProduct Specification Species Human Synonyms PLG Accession P00747 Amino Acid Sequence Protein sequence(P00747, Asn79 Pro466, with C 10*His)

Product Specification


Species Human
Synonyms PLG
Accession P00747
Amino Acid Sequence

Protein sequence(P00747, Asn79-Pro466, with C-10*His) NRKSSIIIRMRDVVLFEKKVYLSECKTGNGKNYRGTMSKTKNGITCQKWSSTSPHRPRFSPATHPSEGLEENYCRNPDNDPQGPWCYTTDPEKRYDYCDILECEEECMHCSGENYDGKISKTMSGLECQAWDSQSPHAHGYIPSKFPNKNLKKNYCRNPDRELRPWCFTTDPNKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPENFPCKNLDENYCRNPDGKRAPWCHTTNSQVRWEYCKIPSCDSSPVSTEQLAPTAPPELTPVVQDCYHGDGQSYRGTSSTTTTGKKCQSWSSMTPHRHQKTPENYPNAGLTMNYCRNPDADKGPWCFTTDPSVRWEYCNLKKCSGTEASVVAPPPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical:45.7kDa Actual:65kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, 1mM EDTA, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Plasminogen (former name profibrinolysin) is an inactive precursor of plasmin. It is a plasma protein that is part of the fibrinolytic system. Plasmin is an important enzyme (EC 3.4.21.7) present in blood that degrades many blood plasma proteins, including fibrin clots. In circulation, plasminogen adopts a closed, activation-resistant conformation. Upon binding to clots, or to the cell surface, plasminogen adopts an open form that can be converted into active plasmin by a variety of enzymes, including tissue plasminogen activator (tPA), urokinase plasminogen activator (uPA), kallikrein, and factor XII (Hageman factor). Plasmin deficiency may lead to thrombosis, as the clots are not adequately degraded. Plasminogen deficiency in mice leads to defective liver repair, defective wound healing, reproductive abnormalities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 1847941004

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Ryan
Omaha, US
★★★★★ 5
Ingredient for Bulletproof coffee, good stuff!
Size: 32 Fl Oz (Pack of 1)
Bulletproof Coffee. Dave Asprey. Look it up. This isn't his MCT oil, which I'm sure is spectacularly better, but I'll use the Pareto principle (80-20 Rule) and settle for a much less expensive version for a slightly lowered benefit. Perhaps I'll upgrade when I'm more of a genius and fabulously wealthy... ;) So, I put this in my morning protein smoothie, which I make cold with pre-brewed coffee that is chilled... Wait, what is MCT Oil? Medium Chain Triglyceride Oil. Basically, it is specially refined coconut oil, where they isolate only the MCT portion of the oil. I'll let you look up why medium chain triglycerides are fantastic. But they ARE fantastic! Worth the read. So what does it do? Dave would say it is brain- fuel. Since our brains are made up mostly of fat, our brain naturally wants (healthy) fats for food. And MCT is some of the best possible oil/fat for that purpose. Plus, MCT has a benefit of being self-preserving, unlike many oils which go rancid (or oxidize) rapidly. Rancid oils are actually sort of toxic, in that they start to have damaging effects instead of beneficial ones. Kind of like the difference between eating a nice juicy steak...or 3 day old roadkill. And yes, I think that's an accurate analogy. How did it work for me? Well, true enough, with the coffee and protein, I do have clear-headed mornings, and I feel energized (provided I get enough sleep the night before!). I have noticed that I don't seem to be hungry as early, and I attribute that to the "full" or satiation effect of the oil. Fats satisfy our hunger needs, because they are valuable to the body. (Even bad fats satisfy, but it's not good for us). Will I buy this again? Absolutely. Probably have a bottle of this in my pantry forever now. And I also have virgin organic cold-pressed (I think) coconut oil as well, which I use for cooking, eating (straight), and use on my skin. MCT Oil is for eating (drinking) in my smoothie, as brain fuel. I've never used Viva Labs before, but happy with them, and will be alert if they have other products I want. The bottle is high quality, and the cap stays tightly closed. Very pleased overall, everything is positive. Glad I chose them for this, and glad this does what I got it for! Taste is faint, not very strong anything. Texture is like a thin mineral oil (viscosity if you want to be technical). As a side note, if I needed a lubricant for the bedroom, I would grab this before the unrefined coconut oil. Not sure how it works with condoms, have not used this with them, so if you are relying on them and this, do your homework on compatibility...might eat some kinds or others.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 3, 2016
J
Verified Purchase
jennifer m eckhart
Fort Morgan, US
★★★★★ 5
it checks every box for clean, high-quality nutrition.
Size: 32 Fl Oz (Pack of 1)
The oil itself is completely flavorless, which makes it perfect for adding to my morning coffee, smoothies, or even drizzling over meals. It blends smoothly and gives me a steady, sustained boost without any jitters or crashes. The 32 fl oz size is also a great value and lasts a long time. If you’re looking for a pure, reliable MCT oil to support focus, energy, or a keto lifestyle, this one is a winner. I Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 30, 2025
D
Verified Purchase
D.A. White
Waukegan, US
★★★★★ 4
Seems to be a good product. Lid, not so much.
Size: 16 Fl Oz (Pack of 1)
This is my first experience with any MCT oil. Took my first tablespoon of this this morning on an empty stomach. After about five minutes I could feel that it had clearly gotten into my system. Was surprised it was so quick. Seems to be pretty potent. The lid is clearly made to help inject and blend the product into a beverage. You cannot squeeze the bottle gently enough to simply dispense the product into a measuring spoon. Probably blew a couple tablespoons down my sink before I finally just took off the lid and poured it. Many screw on lids are of a standard configuration and used across products. I'll have to try to find one on something else. With the product, I'm pretty happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 19, 2025
M
Verified Purchase
Magnus
Chelsea, US
★★★★★ 5
Tasteless
Size: 16 Fl Oz (Pack of 1)
Mixes well enough into coffee. While it floats on the surface it also is effective as it is tasteless and I don't really notice it as I drink my coffee. It's an easy way to incorporate the health benefits.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
A
Verified Purchase
Anthony
Omaha, US
★★★★★ 5
Yup. It's MCT (AFAIK), and its affordable!
Size: 32 Fl Oz (Pack of 1)
Great stuff. Great price. Great bottle! Packaged well, and the bottle design is flawless. It comes with two caps, one traditional cap style, and one hinged with a functional pour spout that prevents getting oil ALL over the bottle and ultimately EVERYTHING else like some other brands I've used in the past. Can't beat the price. Unfortunately, I cannot give a qualitative review as to the quality, as my testing capabilities are limited and any attempt to do so would be highly speculative. However, there is nothing obviously different (good/bad) about this verses competitor products. I will be purchasing regularly! :) ---------Opinion/Observation on overall performance balance for the constrained budget. -------- I think that the largest gain/loss is going to be your overall dietary consumption of quality fats, and reduction in carbs consumed and removal of sugars . E.g, it doesn't matter if your consuming an "metabolically optimized C8 isolated MCT oil" in the morning if you loading up on low quality fats in the afternoon, or if your other ducks are out of line (read: sleep, exercise and greater diet). Your better off spending less on your MCT, and more on your other needs to optimize your equation. In my personal case, I find being able to liberally use a cheap MCT (Viva) in larger quantities dynamically as needed throughout the day to keep myself energized and focused on the task at hand is a much better solution for efficiency than having to "ration" out a C8 isolate. Though I probably spend just as much if not more by using it this way, by being able to consume at a higher quantity, overall performance is greater in this case. Additionally, when consuming with other foods and metabolic efficiency and flavour is not as paramount (or when coconut would taste good), I'll opt for a quality coconut oil, as its also marginally cheaper per ounce. (about 13-15$/32oz compared to 18-20$/32oz for MCT). I have used HealthWorks Coconut oil in the past, and it was absolutely delicious. I recently got Kirkland (as on inspection it seemed to have the same qualities) for pennies on the dollar; but it tastes burnt, so I'm not sure if it was a batch issue, warehouse storage, or simply there processing methods but its defiantly not up to par in a taste test. I'll most likely try Viva in the future, as I've been impressed with them so far. Takeaway: Great product if you like to use a lot of MCT! Just make sure your micros (vitamins and minerals) are in check if you exceed the 50% fat macro level. :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 26, 2016

recommand products