SKU: 20351439222

Human CD63, His tag

Sale price$173.25 Regular price$192.50
Save 10%

Pay in installments of $48.12 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD63, His tagProduct Specification Species Human Synonyms Granulophysin, Lysosomal associated membrane protein 3 (LAMP 3), Lysosome integral membrane protein 1 (Limp1), Melanoma associated antigen ME491, OMA81H Accession P08962 Amino Acid Sequence Protein sequence(P08962, Ala103 Val203, with C 10*His) AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight

Product Specification


Species Human
Synonyms Granulophysin, Lysosomal-associated membrane protein 3 (LAMP-3), Lysosome integral membrane protein 1 (Limp1), Melanoma-associated antigen ME491, OMA81H
Accession P08962
Amino Acid Sequence

Protein sequence(P08962, Ala103-Val203, with C-10*His)
AGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 13.2kDa Actual:17-30kDa
Purity

>95% by SDS-PAGE

Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
  • 12 months from date of receipt, -20 ℃ to -70 °C as supplied.
  • 1 month, 2 to 8 °C under sterile conditions after reconstitution.  
  • Please avoid repeated freeze-thaw cycles. 

Background

CD63 is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak Syndrome. Also this protein has been associated with tumor progression. CD63 is a good marker for flow cytometric quantification of in vitro activated basophils for diagnosis of IgE-mediated allergy.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 20351439222

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lisabeth
New York, US
★★★★★ 5
Elevates my shower routine—luxury scent without the luxury price
I’ve been using the Cremo Palo Santo body wash for a few weeks now, and I’m genuinely impressed. The scent is rich and complex—bright cardamom, dry papyrus, and aromatic palo santo blend together to create a fragrance that’s both grounding and refreshing. It’s like a spa experience in your own shower. The formula lathers up beautifully, turning into a creamy foam that feels moisturizing without being greasy. My skin feels clean and soft afterward, not tight or dry. I appreciate that it’s designed for all skin types, and I haven’t experienced any irritation. What really stands out is the longevity of the scent. It lingers subtly on the skin, and I’ve even noticed it on my clothes the next day. It’s not overpowering, just a pleasant, masculine aroma that makes me feel put-together. For the price, this body wash offers a premium experience. It’s a great way to elevate your daily routine without splurging on high-end brands. I’ll definitely be repurchasing and exploring other scents in Cremo’s Reserve Collection.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 13, 2025
L
Verified Purchase
Lucy
Waukegan, US
★★★★★ 5
smells luxurious
smells so luxurious. i am on my third bottle and just purchased the fragance as well as the bar soap. thats how much i love the fragance. i wills say, its really intense smell so dont recommend if you are sensitive to strong/lingering smells. leaves my skin super soft. great value for the money, honestly suprised that is not more expensive. its advertised for men but i use it too and love. definetly good for women too who like intense woody/smoky scents.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 19, 2025
W
Verified Purchase
Wanzi
Port Orchard, US
★★★★★ 4
Great Value
You are getting a lot for the money when you get this body wash. It smells great and is an overall wonderful product.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 7, 2026
E
Verified Purchase
Ehul Roscoe Davis
Massapequa, US
★★★★★ 5
Smells so good
Love this stuff! Very concentrated. A little goes a long way. Smells amazing and leaves your skin soft and smooth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026
C
Verified Purchase
Christopher McMakin
Lexington, US
★★★★★ 5
A major upgrade from standard drugstore brands—sophisticated scent & better lather.
I have been a long-time user of standard body washes (think Old Spice, Axe, or Dove Men), but I kept seeing hype about Cremo and decided to see if it was worth the slightly higher price tag. After using the 32oz Spice & Black Vanilla for a week, I can confidently say this is a massive upgrade for your shower routine. ​Here is how it stacks up against the typical grocery store brands: ​1. The Scent is on another level: Most cheaper washes smell like generic "Sport" or "Ocean" cologne. This scent is much more complex and earthy. ​Top Notes: It starts with a sharp, spicy kick (that's the cardamom). ​Finish: It settles into a smooth, warm vanilla and tobacco scent. It smells more like a high-end department store fragrance than a soap. ​Staying Power: The scent actually lingers. If you shower in the morning, you will still catch subtle hints of the warm spices for a few hours, which pairs really well with woody colognes. ​2. Performance & Feel: The consistency is thicker than what I'm used to. You only need one solid pump to get a rich lather with a loofah. Crucially, it rinses clean without leaving that "squeaky" residue that dries out your skin, but it also doesn't leave a slick oily film like some ultra-moisturizing washes do. It hits a perfect balance. ​3. Value: The 32oz bottle is substantial. Because the gel is concentrated, I expect this bottle to last 3-4 months easily, making the cost per ounce very reasonable compared to buying smaller bottles of cheaper stuff every few weeks. ​Pros: ​Sophisticated, "grown-up" scent profile. ​High-quality pump (sturdy, doesn't clog). ​Non-drying formula is great for colder months. ​Cons: ​Potency: The scent is strong. If you are sensitive to fragrance or prefer unscented products, this might be overwhelming. The bathroom will smell like it for a good 20 minutes after you're done (which I enjoy, but keep it in mind). ​Verdict: This bridges the gap between basic hygiene and luxury grooming. If you are tired of smelling like "Blue Sport" and want something warmer and more refined for the fall/winter, this is absolutely worth the switch.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 26, 2025

recommand products