SKU: 25845606059

Human ATRX , His tag

Sale price$90.00 Regular price$100.00
Save 10%

Pay in installments of $25.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ATRX , His tagProduct Specification Species Human Synonyms Transcriptional regulator ATRX, ATP dependent helicase ATRX, X linked helicase II, X linked nuclear protein (XNP), Znf HX, RAD54L, XH2 Accession P46100 Amino Acid Sequence Protein sequence(P46100, Gly2250 Asn2450, with C 10*His)

Product Specification


Species Human
Synonyms Transcriptional regulator ATRX, ATP-dependent helicase ATRX, X-linked helicase II, X-linked nuclear protein (XNP), Znf-HX, RAD54L, XH2
Accession P46100
Amino Acid Sequence Protein sequence(P46100, Gly2250-Asn2450, with C-10*His) MGYHEHDSLLDHKEEEELTEEERKAAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRRLQQQYNQQQQQQMTYQQATLGHLMMPKPPNLIMNPSNGGGGSHHHHHHHHHH
Expression System E.coli
Molecular Weight Theoretical:24.9kDa Actual:27kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Transcriptional regulator ATRX also known as ATP-dependent helicase ATRX, X-linked helicase II, or X-linked nuclear protein (XNP) is a protein that in humans is encoded by the ATRX gene. It contains an ATPase / helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. ATRX is required for deposition of the histone variant H3.3 at telomeres and other genomic repeats. These interactions are important for maintaining silencing at these sites. Acquired mutations in ATRX have been reported in a number of human cancers including pancreatic neuroendocrine tumours, gliomas, astrocytomas, osteosarcomas, and malignant pheochromocytomas. There is a strong correlation between ATRX mutations and an Alternative Lengthening of Telomeres (ALT) phenotype in cancers.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 25845606059

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 11 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Ryan T
Fort Morgan, US
★★★★★ 5
A Harrowing Account of Addiction, Recovery, and Relapse
Format: Hardcover
Greg Pizzoli’s The Watermelon Seed offers a deceptively simple yet profound exploration of addiction, recovery, and relapse. Through the crocodile’s obsessive love for watermelon, his panic upon swallowing a seed mirrors the fear and anxiety of losing control. The cycle of indulgence, dread, and inevitable return to the source of both pleasure and distress reflects the cyclical nature of addiction. Pizzoli’s playful illustrations mask a darker undercurrent: the crocodile knows watermelon may harm him — yet he cannot resist. A chillingly accurate portrait of the addictive mind, wrapped in the guise of a children’s story.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 17, 2025
L
Verified Purchase
Lacey Edwards
Lake Worth, US
★★★★★ 5
My kids love this book
Format: Hardcover
My son and daughter ( 4 and 2 ) LOVE this book. It makes them laugh out loud. It is cute and funny. The pictures are adorable. I have purchased it for several friends kiddos over the year.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 20, 2025
A
Verified Purchase
Amazon Customer
Dallas, US
★★★★★ 5
Excellent children's book!
Format: Hardcover
Greg Pizzoli's wonderful book, The Watermelon Seed, is a delight for children and adults alike! The whimsical illustrations he creates, keep children glued to each page. It is fun and enjoyable to read over and over again with a child that just has to have it read every single night to them. The story is sweet, simple and meaningful. Whether you are looking for a book for your child, another child or the child in yourself-dive right in. This one is terrific!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 17, 2018
D
Verified Purchase
DTom
San Leandro, US
★★★★★ 4
Cute but
Format: Hardcover
Caution that some children may be alarmed by the crocodile swallowing the watermelon seed. Know your audience. Otherwise a very cute, silly story that is great for a summer read or watermelon theme lesson.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 25, 2023
F
Verified Purchase
Flipflop
Chelsea, US
★★★★★ 5
A Special Education Treasure
Format: Board book
I bought this book with one student in mind. A third grade autistic, non verbal, girl with a love for books, animals and reflective surfaces (windows, puddles, utensils and mirrors to name a few). The bright, cheerful illustration was the immediate interest upon her first look. The engaging fun story kept her attention. The last page captivated her. What a complete joy to watch! She will now say "Wiggle" when she wants this book - several times a day. She follows along with her finger while I read. I do not read the last page. She does that all ON HER OWN! Did I mention non verbal?! I'm purchasing another as a Christmas surprise for her to have at home. I highly recommend this book as a fixture in the classroom for Special Education and Early Learning.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 12, 2023

recommand products