SKU: 27701012022

Human papillomavirus type 16 E7 Protein

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 22 - Jul 27

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human papillomavirus type 16 E7 ProteinProduct Specification Species Human papillomavirus type 16 Synonyms HPV 16 E7 Accession P03129 Amino Acid Sequence Protein sequence (P03129, Met1 Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Expression System E. coli Molecular Weight Predicted MW: 11. 0 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Conjugation Unconjugated Tag No Tag Physical Appearance Lyophilized Powder Storage Buffer 0.

Product Specification


Species Human papillomavirus type 16
Synonyms HPV 16 E7
Accession P03129
Amino Acid Sequence

Protein sequence (P03129, Met1-Pro98)
MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Expression System E.coli
Molecular Weight

Predicted MW: 11.0 kDa Observed MW: 17 kDa

Purity

>95% by SDS-PAGE

Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer 0.2M PBS, pH7.4
Reconstitution

Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Human papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins. Human papillomavirus (HPV) E7 plays a major role in HPV-induced malignancy, perturbing cell cycle regulation, and driving cell proliferation. Major targets of cancer-causing HPV E7 proteins are the pRB family of tumor suppressors, which E7 targets for proteasome-mediated degradation and whose interaction is promoted through an acidic patch, downstream of the LXCXE motif in E7, that is subject to phosphorylation by casein kinase II (CKII).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27701012022

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
BB
Birmingham, US
★★★★★ 3
Works but will Dry Out Your Skin
Size: 6 Ounce (Pack of 1)
I am a swim instructor at an outdoor pool and this stuff DOES work. I can apply it at the beginning of a 5 hour shift and while I have experienced light tanning it has protected against burning completely without reapplication. The white cast is significant though I don't mind it aesthetically, I know its there for protection . It does rub off on things though so consider yourself warned. Major Con: it is incredibly drying, and the soap needed to scrub it off is A LOT. That coupled with chlorine is a lot for my skin . Still on my sunscreen journey.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
D
Verified Purchase
Dirk D.
Boise, US
★★★★★ 5
The Best
Size: 3 Fl Oz (Pack of 1)
Dry, not greasy, and easy to apply. Lots of protection and leaves skin feeling clean.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 9, 2026
I
Verified Purchase
idgf
Draper, US
★★★★★ 5
Great product makes my skin look dewy and soft with no powdery biproduct
Size: 3 Fl Oz (Pack of 1)
Excellent product. It looks white on my fingertips but absorbs as a clear product which feels soft, cool, and gel-like on my skin. I usually use it with a gel moisturizer but I think one can use it on its own.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2026
V
Verified Purchase
Veronika
New York, US
★★★★★ 5
Sunscreen for Combination and Sensitive Skin
Size: 3 Fl Oz (Pack of 1), Size: 3 Fl Oz (Pack of 1)
I’ve been buying different skincare products because I really want to improve the way my skin looks and feels. My skin type is combination, with a history of acne, some acne marks, enlarged pores (especially on my nose and cheeks), a dull and slightly dry tone, occasional sensitivity, a light expression line on my forehead, and sometimes dry patches. As you can see, I have quite a few concerns, so I have to be careful with the products I use. 💬 I chose this Sunscreen, and I’ve absolutely loved it! The texture is lightweight and keeps my skin well-hydrated throughout the day. My face doesn’t look dull anymore — it looks fresh and naturally glowy, which I really appreciate. I also love how quickly it absorbs without leaving any greasy or sticky feeling. And of course, the most important part: it really protects my skin from the sun.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 15, 2025
M
Verified Purchase
Millie
Louisville, US
★★★★★ 4
Great product but expensive and small
Size: 3 Fl Oz (Pack of 1)
This looks great on the skin, it's a very good product. Expensive for the size though, the tube is more like travel size. I think it's worth it if you have sensitive or acne-prone skin as this didn't break me out like traditional sunscreens, but I think it's expensive for how much you get.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 11, 2026

recommand products