SKU: 34596761877

CXCL4 Protein(C-6His) Protein, Human

Sale price$104.40 Regular price$116.00
Save 10%

Pay in installments of $29.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CXCL4 Protein(C-6His) Protein, HumanProduct Specification Species Human Synonyms CXCL4 protein; PF4 protein; Platelet Factor 4; PF 4; C X C Motif Chemokine 4; Iroplact; Oncostatin A; PF4; CXCL4; SCYB4 Accession P02776 Amino Acid Sequence Glu32 Ser101 with a 6*His tag at the C terminus. EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIK KLLESHHHHHH Expression System HEK293 Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms CXCL4 protein; PF4 protein;Platelet Factor 4; PF-4; C-X-C Motif Chemokine 4; Iroplact; Oncostatin-A; PF4; CXCL4; SCYB4
Accession P02776
Amino Acid Sequence

Glu32-Ser101  with a 6*His tag at the C-terminus.

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIK KLLESHHHHHH

Expression System HEK293
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 5% Trehalose, 5% Mannitol, 1mM EDTA, 0.02% Tween 80, pH6.0.
Reconstitution Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Stability & Storage

Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

Background

Human Chemokine (C-X-C motif) Ligand 4 (CXCL4) is expressed in megakaryocytes and stored in the alpha-granules of platelets. CXCL4 contains several heparin-binding sites at the C-terminal region and binds heparin with high affinity. The active CXCL4 protein is a tetramer. Human and mouse CXCL4 share 64% sequence identity. CXCL4 is chemotactic for neutrophils, fibroblasts and monocytes and plays a critical role in inflammation and wound repair. CXCL4 functions via a splice variant of the chemokine receptor CXCR3, known as CXCR3B. The major physiologic role of CXCL4 appears to be neutralization of heparin-like molecules on the endothelial surface of blood vessels, thereby inhibiting local antithrombin III activity and promoting coagulation. In contrast to other CXC chemokines, CXCL4 lacks chemotactic activity for polymorphonuclear granulocytes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 34596761877

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Coco
Louisville, US
★★★★★ 5
they are gorgeous and functional
Color: Ivory
we got these with our cooktop and it is great value and super easy to clean goes in my dishwasher and love how it cooks and cleans they are perfect and gorgeous in white we been using them on the electric stove and they still look brand new. and they cook everything perfectly
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 8, 2026
D
Verified Purchase
Daisy cat
Whiting, US
★★★★★ 5
A great cooking set for just about any meal.
Size: 11-Piece Set
This is a great set of cookware at a very reasonable price. I was looking to make the switch from using non-stick coating to something more natural to minimize the risk of potential toxins. This stainless steel cook set comes with everything that you need to cook just about any meal. As with any stainless cook set, it does require a different approach to cooking, but it's a good tradeoff to know that you're using steel instead of non-stick coating. The quality feels very sturdy, and I feel like these will last me a long time. They are very easy to clean if you soak and use something like bar keeper's friend for anything that is stuck.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
T
Verified Purchase
Travis H
Natrona Heights, US
★★★★★ 5
Everyday use
Size: 11-Piece Set
I've used these pans for about a year now and they are still holding up great. For everyday abuse they do not faulter. Plus they clean easy. These pans are a great way to get name brand quality without breaking the bank.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
P
Verified Purchase
Phillycheese
Louisville, US
★★★★★ 5
Solid design, long lasting, healthy surface for cooking
Size: 11-Piece Set
I bought this exact set in 2021. I am buying more. With the number of reports about the dangers of pans made with non stick coating I decided i would only use cast iron or stainless steel going forward. These are “amazon brand” but I can say after years of use and abuse they are standing the test of time. Multiple moves, toddlers, rough use and they are all fully functional and work great. I LOVE the teardrop handles. It makes it so easy to hold the handle and the hanging holes on the handles are large allowing you to hang it more places on more things you may already have set up in your kitchen. I think anyone who is looking to get away from cheap, chemically pans off the rack should look at this set!! I have 4 years of proof they are not junk but a great long lasting items that seem to be well made. Higher price than buying a $10 pan at walmart but you get so many pots and pans with lids that will last a lifetime. You can also use stainless steel to cook in the oven so more functionality than most pans and pots you buy of the rack. You will just need to learn how to cook with stainless steel pans (check YouTube lots of instruction there).
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2025
C
Verified Purchase
Claire53
Massapequa, US
★★★★★ 4
Very pretty cookware
Size: 11-Piece Set
This is nice quality cookware for a great price. I have seen cooking shows that tell how to cook in stainless steel without it sticking. Unfortunately, my food still sticks. If I use a lot of oil, it isn’t so bad. One cooking show host says if you get it real hot before you add the oil, it won’t stick. It sticks. I am trying to get away from using Teflon because they say we have a lot of Teflon in our bodies from our cookware. I still go back to my Teflon a lot. But the cookware is very pretty, a nice weight, and cleans up fairly easily. I do soak the skillet before I clean it. I don’t have to do a lot of scrubbing. The sauce pans are great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 10, 2025

recommand products