SKU: 35218220388

Human Alpha-synuclein Protein, His tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 7 - Aug 12

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human Alpha-synuclein Protein, His tagProduct Specification Species Human Synonyms Non A beta component of AD amyloid, Non A4 component of amyloid precursor (NACP), SNCA, NACP, PARK1 Accession P37840 Amino Acid Sequence Protein sequence (P37840, Met1 Ala140, with C His tag) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA Expression System E. coli Molecular Weight Predicted MW: 16. 1 kDa Observed

Product Specification


Species Human
Synonyms Non-A beta component of AD amyloid, Non-A4 component of amyloid precursor (NACP), SNCA, NACP, PARK1
Accession P37840
Amino Acid Sequence

Protein sequence (P37840, Met1-Ala140, with C-His tag) MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA

Expression System E.coli
Molecular Weight Predicted MW: 16.1 kDa Observed MW: 20 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Alpha-synuclein is a neuronal protein that regulates synaptic vesicle trafficking and subsequent neurotransmitter release. It is abundant in the brain, while smaller amounts are found in the heart, muscle and other tissues. In the brain, alpha-synuclein is found mainly in the axon terminals of presynaptic neurons. Within these terminals, alpha-synuclein interacts with phospholipids and proteins. It plays a role in restricting the mobility of synaptic vesicles, consequently attenuating synaptic vesicle recycling and neurotransmitter release. 

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35218220388

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 8 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
P
Verified Purchase
Pooh
Port Orchard, US
★★★★★ 5
Nice peppercorns!
Size: 16 Ounce (Pack of 1)
This is a container full nice fresh whole peppercorns for a reasonable price. I use freshly cracked pepperin my cooking, as well as at the table seasoning and it makes a nice difference in taste.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 17, 2026
G
Verified Purchase
Ginge
Carnegie, US
★★★★★ 5
Peppercorns
Size: 16 Ounce (Pack of 1)
Value size perfect for refilling our pepper mill. Taste is great just the right spice. Peppercorns were fresh. Would order again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
R
Verified Purchase
Ramona O.
Lexington, US
★★★★★ 4
Good pepper, large container for the price
Size: 16 Ounce (Pack of 1)
This is good pepper, a large container and seemed like the best price from what I saw. A great canister to use as a refill for your pepper grinder. Honestly my only complaint is that the container is a bit tall for my cupboards. I guess I'm used to the sort of "standard" size of containers like this that I've picked up at Costco and cooking outlets like Orson Gygi. This is taller than those and was a little tough to fit but it barely worked.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 6, 2025
S
Verified Purchase
Simplified
West Palm Beach, US
★★★★★ 5
Strong, Fresh, and Long-Lasting Black Pepper for Everyday Cooking
Size: 16 Ounce (Pack of 1), Size: 16 Ounce (Pack of 1)
I recently started using this whole black pepper in a 1-pound canister, and it has been a great addition to my kitchen. The peppercorns are fresh, aromatic, and have a strong natural spice that really enhances the flavor of home-cooked meals. One of the best things about using whole pepper instead of pre-ground is the freshness. When I grind it myself, the aroma is much stronger and the taste feels more bold and flavorful. It works perfectly in a pepper grinder and gives me control over how coarse or fine I want it. I’ve used it in soups, marinades, meat dishes, and even simple everyday cooking like eggs and vegetables. It adds a nice heat and depth of flavor without being overwhelming. A little goes a long way, so the large canister lasts quite a while, which makes it very practical for regular cooking. The packaging is simple but sturdy, and it keeps the peppercorns fresh and dry. It’s also convenient for storage in the pantry. Overall, this is a solid, reliable black pepper option for anyone who cooks often. It’s fresh, strong, and versatile, making it a great staple spice for everyday use in the kitchen.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
D
Verified Purchase
Doug
Pawtucket, US
★★★★★ 5
Pepper -Black
Size: 16 Ounce (Pack of 1)
Good, economic and works well for normal household use. Wouldn’t suggest snorting it as that is not its intended purpose.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026

recommand products