SKU: 35752589027

ACVR2B His Tag Protein, Mouse

Sale price$216.00 Regular price$240.00
Save 10%

Pay in installments of $60.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

ACVR2B His Tag Protein, MouseProduct Specification Species Mouse Synonyms ACVR2B, ACTRIIB, HTX4, Activin receptor type IIB, Activin A Receptor Type 2B Accession P27040 Amino Acid Sequence Ser19 Thr134, with C terminal 8*His SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTGGGSHHHHHHHH Expression System HEK293 Molecular Weight 25 35kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag

Product Specification


Species Mouse
Synonyms ACVR2B, ACTRIIB, HTX4, Activin receptor type IIB, Activin A Receptor Type 2B
Accession P27040
Amino Acid Sequence

Ser19-Thr134, with C-terminal 8*His SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTGGGSHHHHHHHH

Expression System HEK293
Molecular Weight

25-35kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Olsen O E. et al. (2020) Activins as Dual Specificity TGF-β Family Molecules: SMAD-Activation via Activin- and BMP-Type 1 Receptors. Biomolecules. 10(4): 519.

Background

Activin proteins that belong to the transforming growth factor-beta (TGF-β) superfamily, exert their biological actions by binding to heteromeric receptor complexes of type I and type II serine/threonine kinase receptors. On ligand binding, type I and II receptors form a stable complex, resulting in phosphorylation of type I receptors by type II receptors with constitutive kinase activity, and subsequently initiates the activation of downstream molecules including the endogenous Smads. ActRIIB, also known as ActRIIB, is a type II receptor containing an extracellular domain (ECD), a transmembrane segment, and a cytoplasmic region that includes the kinase domain. ActRIIB is a receptor for activin A, activin B and inhibin A. Multiple ActRIIB isoforms can also be generated, which bind activin isoforms with different affinities.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35752589027

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.6 ★★★★★
Based on 5 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Angie
Los Angeles, US
★★★★★ 4
Good Start
Format: Kindle
This was the first book in the "Off-Campus" series. Hannah Wells, a focused and reserved music student, and Garrett Graham, the confident captain of the college hockey team whose academic struggles threaten his future. When their paths cross through an unexpected agreement, a friendship begins that gradually deepens into something more meaningful. I normally read YA but I found that I liked both of these characters I also liked the secondary characters as well. This was a pretty good read and I see why it's a good series on prime. This book was well written with no errors in grammar or spelling. I am looking forward to reading the next book in this series.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
K
Verified Purchase
Kunauntubbee
Louisville, US
★★★★★ 5
Hot, Sweet, and Real
Format: Kindle
First I love a hockey romance! Add in fake dating, he falls first, and shared trauma and you have me hooked! This has been on my TBR longer than I want to admit! With the show that came out I wanted to read this first and it did not disappoint! I loved it! Garret and Hannah together crack me up and are so cute! This book had sad, funny, serious, and spicy moments! Highly recommend! The audiobook voice actors did a good job! I would recommend reading the trigger warning page this book does talk about some issues/trama that can be triggering.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
K
Verified Purchase
Katlyn
San Leandro, US
★★★★★ 5
Making my love for hockey (and the players) stronger
Format: Kindle
She manages to create such realistic characters that readers can’t help fall in love with. The Deal is no. exception to that. This book is actually our first introduction to her amazing world of obscenely attractive and crazy talented hockey players at Briar University. Wasting no time, we get straight to the wonderful and hot captain, Garrett Graham. Garrett is a history major in his third year at Briar. Here is where Ms. Kennedy does something different, in shows, movies, and books we often see teachers and professors cutting slack for athletes especially ones that are currently in season. Yeah no, that’s not the case at Briar. Enter: Hannah Wells. If I am being technical, we start of in her perspective however I’m in love with Garrett, so we ignore that. The two of them are taking some sort of philosophical ethics course and when the story kicks off, they are getting their midterms back. You ever have that teacher that literally has either way two high of standards, can’t teach or both? I don’t know what the case is in this situation, but the majority of the class bombs that midterm, except for Hannah (and a few other students). Garrett is among those who failed however he is majorly screwed because if he doesn’t ace this makeup, he is no longer academically eligible for sports. After literally bumping into Hannah on his way out of the lecture hall, he sees her grade and decides that this girl will be his tutor and he won’t take no for an answer. He is relentless in his pursuit of her tutoring him that he goes so far as showing up at her work to beg. Finally, he finds the one thing he can offer to make her say yes: a fake date to catch another guy’s attention. Yeah, that fun cliché. She agrees to tutor him only through the retake because she is too focused on her winter showcase for the music department to tutor him all semester. Predictably speaking, that whole fake dating thing, yeah that backfires. I wonder sometimes if it ever works in any way other than making one of the two people realize they have feelings for each other. Believe it or not though my favorite part of the book wasn’t the romance aspects of it. Yes, I thoroughly enjoyed that don’t get me wrong. It was the way that Hannah and Garrett actually became friends and spent time together as friends outside of studying and trying to get her crush’s attention. They binged Breaking bad, watched stupid documentaries and she hung out with the rest of the team celebrating one of their birthdays. This is something that in my opinion gets missed a lot in romance is that if two people are friends and fake dating, we want to see them actually being friends and not just a couple. Her characters are also so real. Like yes there’s no way this many perfect men exist for her to write 9 books about the hockey players that come through Briar. But that’s not what I mean, I mean her characters have substance to them, they have this wonderful thing that we all as real people have: past traumas. That being said, if you are a person that gets triggered by characters having been abused or sexually assaulted in the past, please consider this your trigger warning. This did all happen prior to the books first page so what we see is the aftermath of the traumas and not the actual events taking place if that makes any difference. If that is you, I would urge you to reconsider reading the story and the rest of this review because I do intend on discussing a little bit of what happens with those situations and how Garrett and Hannah chose to respond to them. Consider this also your spoiler alert as well. When Hannah was 15, she went to a party with friends. At this party she was drugged and raped. Now, roughly 6 years later, we see how this has affected her. She refuses to drink if she is not alone and has some problems with intimacy. The cool thing though is that she uses her friendship with Garrett to help her slowly work through these problems. Once he relatively knows what her hang ups are Garrett never once pressures her or belittles her for them only helping her to slowly move past them in any way he can even if it means he plays the “bodyguard” for a night out with their friends so she can drink and not feel scared. And of course, because this is a romance novel and those two are clearly meant to be he also helps her work through her problems with sex in such a slow and patient way that, in combination with everything else we’ve seen from him, makes all the sense in the world why he is loved not only by her (though she is too dumb to admit it till later) and by all of us as readers. Garrett’s past is not all sunshine and roses either. Son of a former NHL superstar, he had to watch his mother slowly die of cancer and watch as his father’s anger was directed in the form of physical violence at his mother, and later at him. Garrett was routinely abused by his father for years until he learned to hit back, no one saw any warning signs or stepped in ever. All they saw was a retired famous athlete and his equally athletically gifted son. Hannah is the first person he ever felt comfortable opening up to about this and is there for him as a place of support when he is essentially forced to spend thanksgiving with his father and his new girlfriend. She does whatever she can to support him and to remind him that no matter who your parents are, it doesn’t determine who you will be when you are older. This is such an important message that honestly everyone needs to hear as do many of the other men in this series just for different reasons than Garrett. This book is honestly in my opinion perfect, and I don’t think I’ve stopped recommending it to people since the first time I finished it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 30, 2022
C
Verified Purchase
Cheryl A.
Los Angeles, US
★★★★★ 5
Off Campus Book Series
Format: Kindle
I absolutely love the Off Campus TV Series!! I have watched it 5 times already. I ordered the Off Campus Book Series. I just finished reading Book 1 - The Deal. It was absolutely amazing!! It was well written and I fell in love with Garret and Hannah. Love the Characters and both their storylines. I was so excited when reading in the Book that the Hockey Championship was being held at the Wells Fargo Center, Home of the Philadelphia Flyers, in Philadelphia, Pennsylvania. I live 30 minutes from (Philly) Philadelphia Pennsylvania. I would like to shout out to the Author ✍️ very well written!! Can’t wait to read the whole Book 📕 Series!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
C
Verified Purchase
Caroline Winters
Bozeman, US
★★★★★ 5
A Perfect Finale to Off-Campus and Briar U
Format: Paperback
The Legacy was everything I hoped for and more—a perfect conclusion to Elle Kennedy’s Off-Campus world. It felt like catching up with old friends and seeing how far they’ve come since we first met them. I laughed, swooned, and even teared up at times—it’s such a satisfying send-off for a series I’ve loved so much. One of the best parts of this book is how we get to spend time with each of the beloved couples: Hannah & Garrett – Still as sweet and solid as ever, proving that their love is built to last. Grace & Logan – Fun, flirty, and full of chemistry, but also showing real growth in how they handle life’s challenges together. Allie & Dean – Emotional, heartfelt, and just as fiery as they’ve always been—Dean never fails to make me smile. Sabrina & Tucker – Tender, mature, and grounded, yet still so full of love. Their storyline was especially touching to see. Elle Kennedy weaves their stories together seamlessly, balancing humor, heartfelt moments, and romance. Each section gives closure while still keeping things exciting—it’s like getting four mini love stories wrapped into one beautiful package. I highly recommend reading The Legacy after finishing both the Off-Campus and Briar U series. It brings everything full circle, and you’ll appreciate all the cameos, callbacks, and little details so much more. Plus, it’s the perfect lead-in before starting the new Campus Diaries series, since you get that emotional closure first. Overall, The Legacy is a heartfelt, fun, and incredibly satisfying finale that left me with a huge smile. If you loved the Off-Campus or Briar U books, this one is a must-read.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 2, 2025

recommand products