SKU: 45856748938

Adiponectin His Tag Protein, Human

Sale price$135.00 Regular price$150.00
Save 10%

Pay in installments of $37.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Adiponectin His Tag Protein, HumanProduct Specification Species Human Synonyms Adiponectin; 30 kDa Adipocyte Complement Related Protein; Adipocyte complement related 30 kDa protein; ACRP30; Adipocyte; C1q and Collagen Domain Containing Protein; Adipose Most Abundant Gene Transcript 1 Protein; apM 1; Gelatin Binding Protein; ADIPOQ; ACDC; ACRP30; APM1; GBP28 Accession Q15848 Amino Acid Sequence

Product Specification


Species Human
Synonyms Adiponectin; 30 kDa Adipocyte Complement-Related Protein; Adipocyte complement-related 30 kDa protein; ACRP30; Adipocyte; C1q and Collagen Domain-Containing Protein; Adipose Most Abundant Gene Transcript 1 Protein; apM-1; Gelatin-Binding Protein; ADIPOQ; ACDC; ACRP30; APM1; GBP28
Accession Q15848
Amino Acid Sequence ETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTNGGGSHHHHHH
Expression System HEK293
Molecular Weight 36 kDa(Reducing)
Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Adiponectin(ADPN) is a hormone secreted by adipocytes that regulates energy homeostasis and glucose and lipid metabolism. Adiponectin is a new member of the family of soluble defense collagens, in hematopoiesis and immune responses. It is an important negative regulator in hematopoiesis and immune systems and raise the possibility that it may be involved in ending inflammatory responses through its inhibitory functions. Adiponectin is mapped to 3q27 and can protect the organism from systemic inflammation by promoting the clearance of early apoptotic cells by macrophages through a receptor-dependent pathway involving calreticulin. The standard product used in this kit is the product of gene recombination, consisting of 226(19-244) amino acids with the molecular mass of 36KDa after glycosylation.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 45856748938

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Cuba, US
★★★★★ 5
Child approved
Flavor Name: World Explorers Variety Pack, Size: 3.5 Ounce (Pack of 18)
Child loved all the flavors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
S
Verified Purchase
S+B
Draper, US
★★★★★ 5
Taste amazing with good quality ingredients
Flavor Name: World Explorers Variety Pack, Size: 3.5 Ounce (Pack of 18)
Love that I can expose my 6 month old to so many flavors so early on. Way better than rice cereal! I have tasted all flavors myself to see what my baby is eating and everything tastes amazing!!! Just bland, but thats good for babies ♡ good for use crunchy and silky Mamas
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 4, 2025
B
Verified Purchase
Blessed
Massapequa, US
★★★★★ 5
Quality and Taste Your Little Is Sure To Love!
Flavor Name: World Explorers Variety Pack, Size: 3.5 Ounce (Pack of 18)
Toddlers can be super finicky, but the textures and flavors of these Serenity easy to use meals are worth every penny! I appreciate the flavors in this variety pack are exactly what our little loves! When you care enough to give the best, then Serenity is the choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 15, 2025
B
Verified Purchase
Ben F.
Battle Creek, US
★★★★★ 5
Good product, poor directions.
Color: Black, Size: B-88''W-4 Panel
The quality of the product was better than most at this price. The directions could have been much better even though I have an engineering background.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 1, 2025
D
Verified Purchase
Deb J
Omaha, US
★★★★★ 4
Nice partition for my basement
Color: Beige, Size: B-102''-3 Panel
This 3-panel room divider showed up well-packaged with all the parts and even a little tool for putting it together. The instructions were easy to follow, and while one person can definitely assemble it, having two makes it quicker and less frustrating. It does exactly what I needed—gives quick, easy coverage in an open area. I'm using it in my basement to hide the furnace and water heater, and it works great for that. It looks nice overall, but I picked the beige fabric (which is really more of a tan), and the black frame makes it stand out more than I’d like. A white or lighter frame would’ve blended better. Not sure that I would use it anywhere besides the basement It’s lightweight and pretty sturdy. The wheels make it easy to move, but it does get a bit wobbly, and the panel clips need to be readjusted every time you roll it somewhere new. Still, for the price, it’s a solid buy. I’m happy with it and planning to order another one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 21, 2025

recommand products