SKU: 74002092901

EPHB1 Protein

Sale price$345.15 Regular price$383.50
Save 10%

Pay in installments of $95.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 18 - Aug 23

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

EPHB1 ProteinProduct Specification Species Human Accession P54762 1 Amino Acid Sequence K578 A984(end)

Product Specification


Species Human
Accession P54762-1
Amino Acid Sequence

K578-A984(end)

KLQHYSTGRGSPGMKIYIDPFTYEDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITAVPSQPLLDRSIPDFTAFTTVDDWLSAIKMVQYRDSFLTAGFTSLQLVTQMTSEDLLRIGITLAGHQKKILNSIHSMRVQISQSPTAMA

Expression System Baculovirus-InsectCells
Molecular Weight 72.6 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag GST Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 20mM Reduced Glu, 1mM DTT, 0.05% Brij-35, 10% glycerol, pH 7.5
Stability & Storage

Stable for 12 months upon stored at -80℃ from the date of receipt. And avoid repeated freeze-thaws cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 74002092901

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Molly Farrell
Port Orchard, US
★★★★★ 5
Love them!
Color: White-cooling Basic, Size: Queen(Pack of 2)
Love them! After 10 years with our MyPillows, they finally lost their fluff. The reviews I read of the MyPillows of today were not good; they didn’t have as much filling as they used to. These pillows remind me of how fluffy our new MyPillows were 10 years ago!! You sink right into them and can mush them however and they stay. These are way cheaper than the Coop and it’s the same concept; add or remove the filling as needed. The cooling side is a huge plus too! You won’t be disappointed with these pillows!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
H
Verified Purchase
Hello
Waukegan, US
★★★★★ 5
Deserves more Stars
Size: Queen
I was very hesitant to make a pillow purchase off Amazon. Turns out it’s the very best purchase! I had chronic neck issues the chiropractor couldn’t resolve. It was the first time, I had an unsolvable issue. I finally decided to spend the money and buy new pillows. My neck issue was 95% resolved the next morning. I’m not kidding! It’s now 100% resolved after a very short period of time. They are a wonderful gift to myself.! quality is top-notch. The support is fantastic. They adjustability is phenomenal and you can adjust the firmness because they give you extra foam. They’re completely worth every penny. I’m 61 years old, 100 pounds and very active. Waking up with neck strain was horrible.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
B
Verified Purchase
BearFire
Dallas, US
★★★★★ 5
I Hit It With the Dryer and It Became a Real Pillow!
Size: Queen
This DreamyBlue Moon Pillow made a much better first impression than I expected. Out of the package it looked like it needed a pep talk, so I threw it in the dryer to fluff it up and it came back with purpose. Just full on BAM. Pillow achieved. The shape is one of the best parts. It actually feels like a pillow that wants to do its job right. Not too weird, not awkwardly bulky, not one of those ones that looks promising until you lay down and realize your head is now parked on a bag of chopped foam and bad decisions. I also really liked being able to customize it. That part matters more than people think. Pillows are weirdly personal, and most of them give you exactly one option: deal with it. This one lets you adjust the fill until it actually feels right, which is a whole lot better than waking up annoyed and pretending it is fine. And for anyone wondering, mine did not have any weird smell. No chemical funk. No “maybe this needs to live on the porch for a day” situation. It just fluffed up, felt good, and got to work. Overall, this has been a solid win. Comfortable shape, easy to adjust, and none of the usual nonsense. Which, for a pillow, is honestly a strong performance.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 21, 2026
A
Verified Purchase
Amy Bedell
Waukegan, US
★★★★★ 5
Soft yet supportive
Size: Queen
I have been through 4 other pillows in the last year trying to find one that supports but isn't too firm. I gave this one a shot and am really loving it. It's soft, comfortable, supports without hurting my neck or shoulder. I am short so some pillows are too high for me. I'm mainly a siide sleeper, this pillow is great as I can place my head anywhere not just middle of very end like the other pillows I was trying. I can sink into it a little yet still have support and it doesn't crush down. It comes with more filler but haven't needed it. I put it in the dryer on ultra delicate when I first got it and it fluffed nicely. Very happy with this product as I am now getting more sleep.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
E
Verified Purchase
Elmira U.
San Leandro, US
★★★★★ 5
Absolutely in love with this pillow!
Size: King, Size: King
I’m so excited about this purchase — this pillow turned out to be amazing! I’m a side sleeper most of the time, and the way the edges are designed makes it incredibly comfortable and supportive. What really surprised me is that even when I slept on my back (which I normally don’t like), I felt super comfortable. I actually woke up still lying on my back — and that never happens! I know it’s healthier to sleep that way, so I’m really happy about that and hope it becomes a new habit. Before this, I tried a few regular memory foam pillows, but they always felt too firm and my neck would get tired. This one, with the shredded memory foam, is so soft and cozy — it molds perfectly without feeling lumpy. The King size is perfect too — my little Pomeranian loves to rest his tiny head next to mine on the pillow. I don’t know why he does that, but it’s adorable. And I have to mention the packaging — the box was so high-quality and beautifully made that I just couldn’t throw it away. I’m definitely keeping it to store something in. Overall, I’m super happy with this pillow and will be ordering a second one soon. I only got one to test it out, but now I’m totally convinced. Thank you for such an awesome product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 26, 2025

recommand products