SKU: 54291269325

TIMP1 Fc Chimera Protein, Human

Sale price$468.00 Regular price$520.00
Save 10%

Pay in installments of $130.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 10 - Aug 15

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TIMP1 Fc Chimera Protein, HumanProduct Specification Species Human Synonyms TIMP1, CLGI, TIMP Accession P01033 Amino Acid Sequence Cys24 Ala207, with N terminal Human IgG1 Fc

Product Specification


Species Human
Synonyms TIMP1, CLGI, TIMP
Accession P01033
Amino Acid Sequence Cys24-Ala207, with N-terminal Human IgG1 Fc DKTHTSPPSPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKGGGSGGGSGGGSGGGSGGGSDDDDKCTCVPPHPQTAFCNSDLVIRAKFVGTPEVNQTTLYQRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLIAGKLQDGLLHITTCSFVAPWNSLSLAQRRGFTKTYTVGCEECTVFPCLSIPCKLQSGTHCLWTDQLLQGSEKGFQSRHLACLPREPGLCTWQSLRSQIA
Expression System HEK293
Molecular Weight 55-65kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Hornebeck W. (2004) Down-regulation of tissue inhibitor of matrix metalloprotease-1 (TIMP-1) in aged human skin contributes to matrix degradation and impaired cell growth and survival. Pathol Biol. 51(10): 569-573.

2、Soini Y. et al. (2001) Expression of MMP2, MMP9, MT1-MMP, TIMP-1, and TIMP2 mRNA in valvular lesions of the heart. J Pathol. 194(2): 225-231.

Background

TIMP metallopeptidase inhibitor 1 is also known as TIMP1, a tissue inhibitor of metalloproteinases, is a glycoprotein that is expressed from the several tissues of organisms. TIMP1 is a glycoprotein with a molecular mass of 28 kDa produced by a wide range of cell types. Tissue inhibitor matrix metalloproteinase 1 (TIMP1), which belongs to TIMP gene family, is a natural inhibitor of the matrix metalloproteinases (MMPs). Tissue inhibitor of metalloproteinases 1 (TIMP1) was the secreted factor with the strongest male-biased expression in patient-derived pancreatic tumors. Male-specific up-regulation of systemic TIMP1 was demonstrated in PC mouse models and patients. Using TIMP1-competent and TIMP1-deficient PC mouse models, we established a causal role of TIMP1 in determining shortened survival and increased liver metastasis in males.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54291269325

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jacobo
Houston, US
★★★★★ 4
Great Book.
Format: Mass Market Paperback
Its great to be able to go back and read Stokely Carmichael today in his own words. This book provides an excellent overview of what black power means and how the concept originated. Although the book seems a bit dated today, many of the ideas presented are still entirely relevant. Ive only given the book four stars due to its age. Many of the statistics presented are dated, and undoubtedly there are other texts available today that present these ideas in a much better/newer way. But if you are interested in Stokely Carmichael and what he stood for, this is the book to read.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2012
N
Verified Purchase
napoleon robertson,jr
Dallas, US
★★★★★ 5
The paperback was in great shape. I bought one for a friend.
Format: Paperback
There was nothing to dislike about the condition of the book or the shipping. It was on time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2024
T
Verified Purchase
T
Chelsea, US
★★★★★ 5
Excellent articulation of the Black Power initiative within the Civil ...
Format: Paperback
Excellent articulation of the Black Power initiative within the Civil Rights Movement. A detailed view of Black Power, it's objectives, how these would be achieved, as well as it's misinterpretations. An afterword from each author appended in 1992 provides insight, reflection, and perspective on all that's changed, and what hasn't, since the book's publishing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2017
T
Verified Purchase
Twain Two
Belleville, US
★★★★★ 5
Get one while you can
Format: Mass Market Paperback
Any book with the name Stokely Carmichael is a rare find. You can easily find the same book with Kwame Ture as the author since he changed his name and so later editions reflects the name change. Kwame Ture (fka Stokely Carmichael) changed his name for a reason. However, those of us from the sixties can never forget him nor the name Stokely Carmichael.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 4, 2013
R
Verified Purchase
Reverend Davanta Rashad Scruggs Sr.
Battle Creek, US
★★★★★ 5
amazing book
Format: Kindle
I enjoyed every bit of it and it has truly blessed my ministry and work toward an alternative community for our local church.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026

recommand products