SKU: 54663289218

TGFBR2 Fc Chimera Protein, Mouse

Sale price$250.56 Regular price$278.40
Save 10%

Pay in installments of $69.60 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TGFBR2 Fc Chimera Protein, MouseProduct Specification Species Mouse Synonyms AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2 Accession Q62312 1 Amino Acid Sequence Ile24 Asp184, with C terminal Human IgG1 Fc

Product Specification


Species Mouse
Synonyms AAT3, FAA3, HNPCC6, LDS1B, LDS2B, MFS2, RIIC, TAAD2
Accession Q62312-1
Amino Acid Sequence

Ile24-Asp184, with C-terminal Human IgG1 Fc IPPHVPKSDVEMEAQKDASIHLSCNRTIHPLKHFNSDVMASDNGGAVKLPQLCKFCDVRLSTCDNQKSCMSNCSITAICEKPHEVCVAVWRKNDKNITLETVCHDPKLTYHGFTLEDAASPKCVMKEKKRAGETFFMCACNMEECNDYIIFSEEYTTSSPDIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

60-70kDa

Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc
Physical Appearance Lyophilized Powder
Storage Buffer

PBS, pH7.4

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1.Biros E, et al. (2011) Meta-analysis of the association between single nucleotide polymorphisms in TGF-β receptor genes and abdominal aortic aneurysm.  Atherosclerosis. 219(1):218-23.

Background

TGFBR2 is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It is a transmembrane protein. TGFBR2 is comprised of a C-terminal protein kinase domain and an N-terminal ectodomain. The ectodomain consists of a compact fold containing nine beta-strands and a single helix stabilized by a network of six intra strand disulfide bonds. The folding topology includes a central five-stranded antiparallel beta-sheet, eight-residues long at its centre, covered by a second layer consisting of two segments of two-stranded antiparallel beta-sheets. Transduces the TGFB1, TGFB2 and TGFB3 signal from the cell surface to the cytoplasm and thus regulates a plethora of physiological and pathological processes including cell cycle arrest in epithelial and hematopoietic cells, control of mesenchymal cell proliferation and differentiation, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. The formation of the receptor complex composed of 2 TGFBR1 and 2 TGFBR2 molecules symmetrically bound to the cytokine dimer results in the phosphorylation and activation of TGFBR1 by the constitutively active TGFBR2. Activated TGFBR1 phosphorylates SMAD2 which dissociates from the receptor and interacts with SMAD4. The SMAD2-SMAD4 complex is subsequently translocated to the nucleus where it modulates the transcription of the TGF-beta-regulated genes. This constitutes the canonical SMAD-dependent TGF-beta signaling cascade. Also involved in non-canonical, SMAD-independent TGF-beta signaling pathways.Mutations in TGFBR2 gene have been associated with Marfan syndrome, Loeys-Deitz Aortic Aneurysm Syndrome, and the development of various types of tumors.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 54663289218

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michael S. Johnson
Houston, US
★★★★★ 1
Not durable
Color: Nude, Size: Women 9-13
Only used two of them so far. One sock lasted nearly 3 wears. The other broke before I could finish wearing it the second time. Basically useless junk.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 2, 2026
A
annette rainville
San Leandro, US
★★★★★ 4
Thick Silicone Moisturizing Socks
Color: Nude, Size: Women 9-13, Color: Nude, Size: Women 9-13
★★★★☆ Thick Silicone Moisturizing Socks I ordered these silicone moisturizing socks to try for dry heels. Unlike typical fabric spa socks, these are made entirely of soft silicone and are noticeably thicker and very stretchy. When I first took them out of the package there was a visible fold line in the silicone. It appears to be from how they were folded in the packaging rather than a defect in the material. The silicone itself feels durable and flexible. The design works like a full silicone sleeve that traps moisturizer against your skin. I applied Aquaphor first and then slid these on so the moisture stays in contact with the skin longer. One thing I noticed right away is that the silicone feels cool when you first put them on, which is actually pretty comfortable. The bottoms have a zig-zag textured pattern that gives some grip if you need to stand briefly, though these seem better for relaxing while moisturizer absorbs rather than walking around much. The ankle opening is the tightest part of the sock. It stretches, but it’s noticeably snug compared to the rest of the silicone, which helps keep them from sliding off. For sizing reference, I wear a women’s 7.5–8 shoe and the size Large fits comfortably. There’s plenty of stretch and I can wiggle my toes easily, so they should accommodate larger feet as well. They’re also easy to clean. After using them you can simply wash them with soap and water and let them dry completely before storing or using them again. Overall these appear well made with thick silicone and plenty of stretch. If you use moisturizing socks or heel treatments, these work well for keeping lotion in place while your feet absorb it. Since this set comes with two pairs for about $10, the price seems pretty reasonable for something reusable like this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026
T
Verified Purchase
Tammy James
Lowell, US
★★★★★ 5
HEALTH & BEAUTY
Flavor Name: XL silicone socks 2 pairs
LOVE IT
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
B
Verified Purchase
Barb W
Bozeman, US
★★★★★ 3
Stains easily. Tight for men's size 11 feet
Flavor Name: XL silicone socks 2 pairs, Flavor Name: XL silicone socks 2 pairs
Husband wore dark cotton socks over these gel foot covers overnight and the covers picked up color from the socks. Tried hand washing, even dabbing with a bleach soaked paper towel, but the stains remained. The covers are a bit tight for men's size 11. Edit: After a few more hand washings the stains began to fade. However one tore around the leg opening when taking it off.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 10, 2024
D
Verified Purchase
DD
Phoenix, US
★★★★★ 1
Worthless. Tore on first use.
Flavor Name: XL silicone socks 2 pairs
The first time I put these on my feet, the whole toe broke right through. They were a proper fit and my feet are well pedicured. Just very poor quality. I don’t recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 2, 2024

recommand products