SKU: 5474893088

LILRA6/CD85b/ILT8 His Tag Protein, Human

Sale price$324.00 Regular price$360.00
Save 10%

Pay in installments of $90.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LILRA6/CD85b/ILT8 His Tag Protein, HumanProduct Specification Species Human Accession Q6PI73 1 Amino Acid Sequence Gly24 Asn447, with C terminal 8*His

Product Specification


Species Human
Accession Q6PI73-1
Amino Acid Sequence Gly24-Asn447, with C-terminal 8*His GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVENGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 60-7 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

LILRA6, Leukocyte Immunoglobulin-like Receptor subfamily A, member 6, also called CD85b and ILT8.The leukocyte immunoglobulin-like receptor (LILR) multigene family is a family of paired receptors composed of inhibitory and activating forms, which are highly homologous in their extracellular regions and different in their intracellular regions. LILRA6 is the activating forms, which have two or four Ig-like domains with short cytoplasmic tail and associate with FcRγ chain containing immunoreceptor tyrosine-based activation motifs. LILRA6 (ILT8/CD85b) and LILRB3 (ILT5/CD85a) are paired receptors expressed by myelomonocytic leukocytes. LILRA6 and LILRB3 have high similarity in their extracellular domain, making them further difficult to distinguish., and mAbs generated against these receptors bind to neutrophils. In addition, LILRA6 is correlated with susceptibility to atopic dermatitis. LILRA6 on the surface of macrophages induces and regulates cytokines such as IL-4, IL-10, IL-17, TNFα and IFN-γ.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 5474893088

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michelle K
Charlottesville, US
★★★★★ 5
Gentle soap, great for hands and body!
I love how gentle this oatmeal soap is. It’s perfect for sensitive skin and doesn’t irritate my hands even when they are rough. I keep one at my sink and one in the shower. The natural scent is lovely and not overpowering. A must-buy for those looking for a mild cleanser!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026
S
Verified Purchase
seekro
Lake Worth, US
★★★★★ 5
Itchy, red skin BE GONE!
My 94 year old father has recently had a terrible resurfacing of his psoriasis with red, itchy, flaky sores all over his body! It's been so bad that he can't even sleep at night. My heart has been aching for him BUT he is finally getting some relief from this amazing soap!! I just saw him yesterday and, compared to two weeks ago, the redness and itching has lessened considerably. Plus, he loves the way it smells! What a true JOY to know he is on the mend, in part because of this product. I am about to purchase another bar for my sister who suffers the with the same issue. THANK YOU fo making a product that actually does what it claims to do!!!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 26, 2025
R
Verified Purchase
Raizy G
West Palm Beach, US
★★★★★ 5
Great Product
I’ve been using this all-natural eczema soap for the past few weeks, and I’m genuinely impressed by the results. As someone who has struggled with eczema flare-ups for years, I’ve tried countless products, but this soap stands out. First off, the ingredients are truly natural—no harsh chemicals, fragrances, or preservatives. The soap is made with soothing, skin-friendly components like coconut oil, shea butter, and chamomile extract. It lathers up nicely, creating a gentle, creamy foam that feels luxurious on the skin. What really stands out is how gentle it is on my sensitive skin. Unlike many other soaps I’ve tried, this one doesn’t dry out or irritate my eczema patches. In fact, it has a calming effect and seems to reduce redness and itching after just a few uses. I’ve noticed that my skin feels softer and more hydrated, which has helped prevent flare-ups. The scent is mild and pleasant—not overpowering, but just enough to give you a fresh, clean feeling without triggering any sensitivities. Overall, I’m thrilled with this eczema soap. It’s not only effective at soothing and moisturizing my skin, but it’s also a relief to know that I’m using something that’s completely natural and safe. If you suffer from eczema or other skin sensitivities, I highly recommend giving this soap a try. It’s definitely become a staple in my daily skincare routine.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 5, 2025
M
Verified Purchase
mary l
Alexandria, US
★★★★★ 5
eczema soap
this is the best soap for my grandson he has eczema , cleared his skin after one or two baths then i lotion down with with the eczema lotion and his skin is so smooth and it's actually beautiful I will always bath him in this soap again and forever he doesn't inch anymore ,no more broken skin it holds moisture because it kind of seems like it's dry when you take taking out of bath but it healing up patches of dry skin I was happy to go see them go away but it's penetrates in the skin I don't know it's just remove all roughness no more problems thanks excellent products and
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 19, 2025
S
Verified Purchase
Stephen C
Port Orchard, US
★★★★★ 4
Expensive, but works if you have a skin condition.
Expensive, but good soap if you have a rash.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 3, 2025

recommand products