SKU: 58239173435

CEACAM-6/CD66c His Tag Protein, Cynomolgus

Sale price$234.00 Regular price$260.00
Save 10%

Pay in installments of $65.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 23 - Jul 28

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CEACAM-6/CD66c His Tag Protein, CynomolgusProduct Specification Species Cynomolgus Synonyms CEACAM6, CD66c, CEAL, NCA Accession XP_014979566. 2 Amino Acid Sequence Gln35 Gly320, with C terminal 8*His

Product Specification


Species Cynomolgus
Synonyms CEACAM6, CD66c, CEAL, NCA
Accession XP_014979566.2
Amino Acid Sequence Gln35-Gly320, with C-terminal 8*His QLTIESRPFNVAEGKEVLLLAHNLPQNTLGFNWYKGERVDAKRLIVAYVIETQQTTPGPAHSGRETVYSNASLLIQNVTQNDTGSYTLQVIKGDLVNEEATGRFWVYPELPKPYITSNNSNPVEDKDAVDFTCEPDIHSTTYLWWVNDQSLPVSPRLQLSNGNRTLTLLSVKRNDAGAYECEIQNPVSANLSDPVILNVLYGPDVPTISPSNSNYRPGENLNLSCHAASNPTAQYSWFVNGTFQQSTQELFIPNITVNNSGSYMCQAYNSATGLNRTTVMMITVSGGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 55-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Duxbury M S. et al. (2004) Overexpression of CEACAM6 promotes insulin-like growth factor I-induced pancreatic adenocarcinoma cellular invasiveness. Oncogene. 23(34): 5834-5842.

2、Lewis-Wambi J S. et al. (2008) Overexpression of CEACAM6 promotes migration and invasion of oestrogen-deprived breast cancer cells. Eur J Cancer. 44(12): 1770-1779.

Background

Carcinoembryonic antigen-related cell adhesion molecule 6 (non-specific cross reacting antigen) (CEACAM6) is also known as CD66c (Cluster of Differentiation 66c), CEAL, NCA, and is one of seven human CEACAM family members within the immunoglobulin superfamily. Human CEACAM-6 is a 90 kDa, GPI-linked membrane protein that contains a 34 amino acid (aa) signal sequence, a 286 aa extracellular domain (ECD), and a 24 aa hydrophobic C-terminal propeptide. CEACAM-6 contains one N-terminal V-type Ig-like domain (N domain), followed by two C2-type Ig-like domains. It shows considerable glycosylation, including (sialyl) LewisX, which mediates binding to E-selectin, galectins and some bacterial fimbrae. CEACAM family members are widely expressed in epithelial, endothelial, and hematopoietic cells, including neutrophils, T-cells, and NK cells. CEACAMs appear to be capable of transmitting signals that result in a variety of effects depending on the tissue, including tumor suppression, tumor promotion, angiogenesis, neutrophil activation, lymphocyte activation, regulation of the cell cycle, and regulation of adhesion. CEACAMs have now been associated with numerous intracellular signaling processes including cell adhesion, cell growth, recognition and differentiation, angiogenesis, and apoptosis.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 58239173435

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kay K
Chelsea, US
★★★★★ 5
Do away with vet teeth cleaning. Great product.
Color: Monster Bone, Size: XX-Large
My large dogs love these. It keeps their teeth clean and no tarter or cavities after 4 years of using. It has even helped an adopted older dog to have stronger teeth. They don't ingest anything, so safe to chew on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 18, 2025
K
Verified Purchase
KP85
Alexandria, US
★★★★★ 4
Great for chewers
Color: Knuckle Bone, Size: XX-Large
I have a 13 month old 56 lb boxer/rottie mix who is a medium chewer and this bone is great for him. No splintering, doesn't make a mess, and hard enough to make him work without any danger of him breaking teeth, getting cut, or choking. We gave it to him a couple of weeks ago and based on wear I'm confident it will last him a long time (many months at least). I was a little hesitant about giving my animal a product that contained nylon, but after a scary experience giving a rawhide bone to a previous foster dog, I was told this was a much safer option and now I agree. This bone is very dense and very hard, so it makes an awful noise when my dog drops it on my hardwood floor. We are also careful to make sure he doesn't drop it on our bare toes, because that would be quite unpleasant. Be aware that the chewed edges also get really rough because of the way the bone wears, so they can become a magnet for dog hairs or fabric threads. This hasn't been a problem for us (we just encourage our pup to chew it on his bed and take it away from him when we are watching a movie so the noise isn't bothersome), but it is good to know. Update: We've had Winston for 5 months now and in that time he has gained 5 lbs of muscle. He loves his Nylabone! It is still going strong and I think he will be able to use this well through his one year adoptiversary. The only issue we have with this bone is that the edges can get sharp and sometimes will cut his mouth. He doesn't notice and just wants to keep chewing, but we usually take the bone away at that point for a bit. My boyfriend has taken the bone and used a power sander on it a few times now to remove all the sharp edges. We only have to to in once every couple of months but it makes a big difference.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 18, 2016
R
Verified Purchase
ragtop
Dallas, US
★★★★★ 5
Nice treat/toy
Color: Knuckle Bone, Size: XX-Large
Dogs love these.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
G
Verified Purchase
Gandalf the Gradient
Phoenix, US
★★★★★ 5
The best toy my dog has
Color: Monster Bone, Size: XX-Large
Our lab mix is a very ambitious chewer - forget retrieving... he seems to think his "job" in life is to destroy things with his teeth. He's very methodical about it; he'll chew and chew and chew, targeting the object's weakest points, until all that remains is a littering of coin-sized remnants. He even started to make progress on his heavy duty black Kong within about a week. By the time he was about 8 months old, we figured out that the only toys he can be left alone with are the ones made by Nylabone. He has all their models: dinosaurs, rings, small bones, and branches. These Nylabone toys are a hard plastic that chips off in tiny little shards. He's happy because he feels like he's making progress (even though it takes him a long time to do so) and we're happy because the toys last a relatively long time and he can't swallow anything that might hurt him. He does leave tiny plastic shavings on the carpet, but we have to vacuum a lot anyways because of his fur, so it's not a big deal. Of all his Nylabone toys, this is the best (and probably his favorite of the bunch). He really likes the size - just right for him to prance around with and show off. Although he's had it for four months, it's still smooth enough in the middle that we can hold it for him comfortably, and it's retained its original shape (unlike dinosaur and branch). If we could just train him not to drop this on our feet when he wants attention(it weighs a few pounds and has gotten a bit pokey on the ends)this would be the perfect toy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 31, 2012
T
Verified Purchase
Tiffany couch
New York, US
★★★★★ 5
Great toy for your fur baby.
Size: Pack of 3, Color: Pacifier, Size: Pack of 3, Color: Pacifier
My husky’s all time favorite toy! He’s obsessed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 20, 2026

recommand products