SKU: 61705221753

CD47 His Tag Protein, Mouse

Sale price$243.00 Regular price$270.00
Save 10%

Pay in installments of $67.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

CD47 His Tag Protein, MouseProduct Specification Species Mouse Antigen CD47 Synonyms MER6, IAP, OA3 Accession Q61735 Amino Acid Sequence Gln19 Lys140, with C terminal 8*His QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKGGGSHHHHHHHH Expression System HEK293 Molecular Weight 33 43kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized

Product Specification


Species Mouse
Antigen CD47
Synonyms MER6, IAP, OA3
Accession Q61735
Amino Acid Sequence

Gln19-Lys140, with C-terminal 8*His 
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEKGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 33-43kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Brown E J. et al. (2001) Integrin-associated protein (CD47) and its ligands. Trends Cell Biol. 11(3): 130-135.

Background

CD47, also known as Integrin-associated protein (IAP), is a typical representative of the "marker of self" of targets expressed by all types of cells. CD47 is a glycoprotein with an immunoglobulin variable N-terminal domain, five transmembrane domains, and a short C-terminal intracellular tail with four variably different splicing isomers, resulting in four isoforms. CD47 is an immune cell group that plays a major role in targeted tumor immunotherapy. CD47 expressed by cancer cells interacts with SIRP-α and SIRP-γ expressed by NK cells to protect cancer cells from phagocytosis and elimination. CD47 was highly expressed in a variety of solid tumor cells and malignant hematoma cells, and its expression level was positively correlated with disease progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 61705221753

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Nancy
Grantham, US
★★★★★ 3
Won’t stay in place
Color: Blue, Size: Large
While the leash was nicely made, the lead would not stay in place. The slide to hold the “O” ring in place kept sliding there for the leash would loosen. The padded handle was nice for sure
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 1, 2025
M
Verified Purchase
Maegan C.
Phoenix, US
★★★★★ 5
Great leash
Color: Blue, Size: Large
Good quality and like the 2nd handle. Go for it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 18, 2026
B
Verified Purchase
Brandee Martinho
Lexington, US
★★★★★ 5
The dogs loved it! Will buy again.
Style: Squeaky Chicken
My dogs have really enjoyed all the layers to this toy. It squeaks and has a noisy film on the inside of the cloth that they really like. The toy itself is very stiff and rigid but they like that. It’s been about 3 months and they recently broke through the pink layer so it lasts quite a while. It was a challenge for them to get the layer off once they had broken through the stitching so it would keep him occupied for a very long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 21, 2026
R
Verified Purchase
Randy C.
Bozeman, US
★★★★★ 5
My dog LOVES this, but...
Style: Squeaky Duck
My dog loved this right out of the box, she didn't learn to squeak it for a couple of hours, but she just stopped playing with her other toys, ragged as they may be... My dog is a Manchester/hound dog mix, of some sort, I'm only sure about the Manchester, she resembles them in look, size, weight, and all else. She weighs approximately 20-ish pounds, or so. With that said, like I said, she loves it, so much so that within 16 waking hours after its arrival she brought me the inner squeaker, the body was in the kitchen. :) She tore off the top part of the head and gained access to the squeaker, and EXACTLY as advertised and other reviews, it is a really good squeaky toy, she really doesn't seem to mind that the outer portion is gone, the (seemingly) durable squeaker might actually last. She can still play with the 'body', the toy is made that when (not if) they rip off an appendage, the nentire innards WILL NOT come out. It's a well designed toy in that respect. So, at times she will play with that too, she has brought me the BODY several times too, My dog is a really CRAZY chewer, she is somewhere under a year old and she will chew on anything that she is in front of her, including rocks, a blade of grass as she runs by, furniture legs, window sills, you name it, she has eaten it. She is a problem dog, but we picked her, and we'd do the same if it was our kid, we wouldn't throw them out. :) She has to be watched constantly, that is not the most fun, but, like they say, 'It is what it is'. I mention all of that to show that even though she is a crazy chewer, the rubber portion of the toy is still 'with us', for now, I will update this if anything else develops, and I am sure it will. Oh yeah, I really need to add, I don't think that the makers can make a chew toy 'outer' from anything that will last that long, not unless you go to a rope material, and I did not want that, it can be swallowed and cause more trouble. (Fabric can be swallowed too, but it's at least softer...) So, really, more than likely you can't get any better than this if your dog is a crazy chewer too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 1, 2023
A
Verified Purchase
Amanda Pike
Belleville, US
★★★★★ 1
Awful Durability
Style: Squeaky Chicken
My dog had this toy for all of 30 minutes an COMPLETELY destroyed it. He is not an aggressive chewer, and has had plenty of rip and reveal toys from Bark Box last WEEKS. I thought I'd try out another brand, but I will be swiftly placing a Bark Box order. I am very disappointed in the durability and quality of this toy thay is supposed to survive non-agressive chewing. If I could give 0 stars, I would have.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026

recommand products