Pay in installments of $77.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Jul 23 - Jul 28
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
CEACAM-3/CD66d His Tag Protein, HumanProduct Specification Species Human Synonyms CEACAM3, CD66d, CEA, carcinoembryonic antigen related cell adhesion molecule 3, CGM1, W264, W282 Accession P40198 Amino Acid Sequence Lys35 Gly155, with C terminal 8*His KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 24kDa Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation
Product Specification
| Species | Human |
| Synonyms | CEACAM3, CD66d, CEA, carcinoembryonic antigen-related cell adhesion molecule 3, CGM1, W264, W282 |
| Accession | P40198 |
| Amino Acid Sequence | Lys35-Gly155, with C-terminal 8*His KLTIESMPLSVAEGKEVLLLVHNLPQHLFGYSWYKGERVDGNSLIVGYVIGTQQATPGAAYSGRETIYTNASLLIQNVTQNDIGFYTLQVIKSDLVNEEATGQFHVYQENAPGLPVGAVAGGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 20-24kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Schmitter T. et al. (2007) The Granulocyte Receptor Carcinoembryonic Antigen-Related Cell Adhesion Molecule 3 (CEACAM3) Directly Associates with Vav to Promote Phagocytosis of Human Pathogens. The journal of immunology. 178: 3797-3805. 2、Swanson K V. et al. (2001) CEACAM is not necessary for Neisseria gonorrhoeae to adhere to and invade female genital epithelial cells. Cellular Microbiology. 3(10): 681-691. |
Background
Carcinoembryonic Antigen-related Cell Adhesion Molecule 3 (CEACAM-3), or CD66d, is part of the CEA protein family consisting of CEACAMs and the pregnancy-specific glycoproteins (PSGs). Both CEACAM and PSG molecules have been identified in humans and belong to the much larger glycosylphosphatidylinositol (GPI)-linked immunoglobulin (Ig) superfamily. Human CEACAM-3 is ~35 kDa, consisting of an extracellular domain (ECD) containing one IgV-like domain, a single transmembrane domain and a cytoplasmic tail. CEACAM family members are widely expressed in epithelial, endothelial, and hematopoietic cells, including neutrophils, T-cells, and NK cells. CEACAMs appear to be capable of transmitting signals that result in a variety of effects depending on the tissue, including tumor suppression, tumor promotion, angiogenesis, neutrophil activation, lymphocyte activation, regulation of the cell cycle, and regulation of adhesion. CEACAMs have now been associated with numerous intracellular signaling processes including cell adhesion, cell growth, recognition and differentiation, angiogenesis, and apoptosis. CD66d antibody increases neutrophil adhesion to the monolayer of human umbilical vein endothelial cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.3 ★★★★★
Based on 10 reviews
Sort
Product Reviews
★★★★★ 2
Destroyed in under 10 minutes
Size: 9 in, Color: Large Bone
I bought 2 of these toys, one for my 9 year old great dane who isn't an aggressive chewer, and one for my 6 month old puppy who is average.
In less than 10 minutes both were destroyed and my dane managed to swallow a good chunk.
I wasn't surprised when they both had small holes on the ends and started pulling the stuffing out. The stuffing and squeakers were confiscated immediately, but I let them keep chewing. By the time I came back from throwing the insides away, both dogs had chewed the toys in half and my dane swallowed a chunk when he saw me coming. The puppy was going to do the same thing, but luckily we're working on his "drop" command so he was excited enough for the bigger payout and dropped it.
They didn't just come apart at the seams, the whole toy ripped in half making it too easy to swallow. Neither of them are aggressive cheers and the toys didn't hold up at all. A stuffed animal toy would have lasted longer (and has any time I've allowed it). 10 minutes of playtime is probably too generous , but I'm trying to be fair. If I hadn't been right there watching them, they both would have been able to swallow the whole thing in minutes. Definitely not safe for any amount of actual chewing.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 14, 2025
★★★★★ 5
The perfect teething toy for a puppy of any size - apparently indestructible!
Size: 9 in, Color: Large Bone, Size: 9 in, Color: Large Bone
I ordered this product for an overly excitable, destructive corgi chihuahua mix puppy, who was teething. He was a foster and managed to destroy, almost immediately, every toy I had on-hand for him, and toys I picked up at the local pet store. I was very concerned he'd swallow parts of toys, which can lead to fatal intestinal blockages, not to mention extremely high vet bills which I couldn't cover as a simple foster mom. When it arrived, I crossed my fingers that the "Seam Protection - doubled-stitched seams with heavy duty thread" would actually add "extra durability." And I was NOT disappointed! The bone shape of the toy would probably fit comfortably in the mouth of any dog or puppy, as you can see from photo #4. What's coolest about the shape of this toy is the pup can sink all of his or her teeth into it, providing comfort for the entire mouth and not just a few teeth or only one section of its mouth at a time. I was much more experienced as a kitten foster mom, and had had similar difficulties finding teething toys for kittens. This toy is thin and light weight enough that I imagine it could provide relief for little kitten mouths, also, but I didn't get to find out, as my little foster pup chose this as his #1 favorite toy and brought it with him to his forever home. I wanted to know how long it would take before he'd destroy it, though (picture 5 he'd had this Dura-Fused bone toy for a few hours short of one week, and the last photo - you'll see he'd not even undone a small portion of the seam!) Overall I would highly recommend this product for teething babies of almost any species. As far as I could tell it is indestructible. Almost seven days of constant gnawing and he'd not even taken one stitch out, created any tear or rip, let alone, gotten close to being able to swallow the squeaker (always a fear!). I imagine months later, he's still been unsuccessful at ripping/tearing this toy at all. I'd gladly buy again should I foster any dog or puppy - the company lives up to its moniker, Ethical Products, because they've produced a no-frills and apparently indestructible squeak toy which I'd have no fears of leaving with a teething puppy unsupervised. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 28, 2020
★★★★★ 3
Good tug toy
Size: 15 in, Color: Retriever
I have a doberman that shready everything in 2.5 seconds. This lasted a few days so was impressed for the cost. Would buy again as he really liked it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 28, 2025
★★★★★ 5
My dog’s new favorite
Size: 8 in, Color: Squirrel
didn’t expect much for the price but my dog actually loves this thing. It’s tough enough to hold up to regular chewing and the leather gives it a nice texture that’s different from the usual plush toys. He carries it around like it’s his prize. It’s not indestructible and if your dog is a heavy shredder it probably won’t last forever but for moderate chewers it holds up way better than a lot of toys I’ve tried. Definitely worth grabbing again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 19, 2025
★★★★★ 4
Not for gnawers
Size: 11.5 in, Color: Bear
I was hoping this would work for my teenage ACD and save my leather goods from being chewed on.
He gnawed on it quietly I was thrilled. But I had to take it from him within a few minutes. Gnawing apparently equals chewing pieces off.
Not made for chewers or gnawers.
It seemed to be well made, was soft, was actually a fairly good size and didn’t get gross when it got spitty. Just didn’t work out for Captain chaos destructor of all.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026