SKU: 66983101906

BMPRIA/ALK-3 His Tag Protein, Mouse

Sale price$212.40 Regular price$236.00
Save 10%

Pay in installments of $59.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Jul 21 - Jul 26

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

BMPRIA/ALK-3 His Tag Protein, MouseProduct Specification Species Mouse Antigen ALK 3 BMPRIA Synonyms 10q23del; ACVRLK3; ALK3 Accession Q9BXN2 Amino Acid Sequence Gln24 Arg152, with C terminal 8*His QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRGGGSHHHHHHHH Expression System HEK293 Molecular Weight 20 28kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag

Product Specification


Species Mouse
Antigen ALK-3/BMPRIA
Synonyms 10q23del; ACVRLK3; ALK3
Accession Q9BXN2
Amino Acid Sequence

Gln24-Arg152, with C-terminal 8*His QNLDSMLHGTGMKSDLDQKKPENGVTLAPEDTLPFLKCYCSGHCPDDAINNTCITNGHCFAIIEEDDQGETTLTSGCMKYEGSDFQCKDSPKAQLRRTIECCRTNLCNQYLQPTLPPVVIGPFFDGSIRGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 20-28kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Proc Natl Acad Sci U S A. 2002 Mar 5;99(5):2878-83. Epub 2002 Feb 19.

Background

Activin receptor-Like Kinase 3 (ALK-3), also known as Bone Morphogenetic Protein Receptor, type IA (BMPR1A), is a type I receptor for bone morphogenetic proteins (BMPs) which belong to the transforming growth factor beta (TGF-β) superfamily. The bone morphogenetic protein (BMP) receptors are a family of transmembrane serine/threonine kinases that include the type I receptors BMPR1A (this protein) and BMPR1B and the type II receptor BMPR2. ALK-3 plays an essential role in the formation of embryonic ventral abdominal wall, and abrogation of BMP signaling activity due to gene mutations in its signaling components could be one of the underlying causes of omphalocele at birth.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 66983101906

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 16 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
adam
Natrona Heights, US
★★★★★ 5
Way above expectations
Color: White
I was originally looking to purchase a more expensive brand to match the smaller purifier I own but this one was on sale, considerably less expensive than the one I had my eye on. I decided to give the mooka a shot and I was highly impressed. Being a smoker, I was just looking for something to help a little with air quality, I was not expecting this thing to completely filter all the air in the room, removing all the smoke and leaving behind completely pristine, clean air in 30 minutes! As I was smoking, the purifier automatically kicked into high gear, did its job and returned to the near silent setting. Awesome! The machine displays a number that corresponds with the current air quality and a light that changes from red to green, depending on the amount of particles in the air while the fan speed runs accordingly. This feature works well, smoking, cooking or anything that releases particles will instantly be detected. The build quality is on par with the more expensive unit that I have but honestly, I prefer this machine, regardless of price! During normal operation, you can barely hear it but it does get louder when the fan ramps up. On it’s higher setting, it is as loud as a box fan on medium speed and when the mooka goes max speed, it matches the sound level of a box fan set to high speed, if that helps.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 19, 2026
B
Verified Purchase
Beth J
Lowell, US
★★★★★ 5
Must have for allergies!
Color: White, Color: White
This was a great purchase! The quality is great. We all have allergies and cats and this has helped a ton! We breathe so much better. No more waking up hacking lol. Its also so quiet I forget it's on sometimes. Removes all dust and other allergens. A must have for allergies
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
Q
Verified Purchase
Queezzyy
West Palm Beach, US
★★★★★ 5
Solid purchase for everyday use.
Color: Orange
Can’t really say to much about these. They have a strong magnet and are durable enough for everyday use. I use them to hang my compression leggings from normatec as well as other accessories. They work well and are at an affordable price. Hook size is ok. I feel like most items you would hang have no issue. Have not loaded them with to much weight but I’m sure they can hold a fair amount.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
K
Verified Purchase
Kevin D. Gebert
Belleville, US
★★★★★ 5
can always use more
Color: Black
I keep buying more of these for fitness equipment storage. I got long and short hook models and very strong magnets hold up pull down attachments weighing 10lbs or more. Works great for belts, carabiners and anything you want to organize in the weight room.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2026
K
Verified Purchase
Kit kat
Massapequa, US
★★★★★ 5
Strong and durable
Color: Orange Hooks
I got this to hang my water hose on the frame of my metal porch. The magnet is super strong. I'm impressed!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026

recommand products