Pay in installments of $90.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 15 - Aug 20
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
LRP10 His Tag Protein, HumanProduct Specification Species Human Synonyms LRP10, LRP9, MST087, MSTP087 Accession Q7Z4F1 Amino Acid Sequence His17 Lys440, with C terminal 10*His
Product Specification
| Species | Human |
| Synonyms | LRP10, LRP9, MST087, MSTP087 |
| Accession | Q7Z4F1 |
| Amino Acid Sequence | His17-Lys440, with C-terminal 10*His HPDRIIFPNHACEDPPAVLLEVQGTLQRPLVRDSRTSPANCTWLILGSKEQTVTIRFQKLHLACGSERLTLRSPLQPLISLCEAPPSPLQLPGGNVTITYSYAGARAPMGQGFLLSYSQDWLMCLQEEFQCLNHRCVSAVQRCDGVDACGDGSDEAGCSSDPFPGLTPRPVPSLPCNVTLEDFYGVFSSPGYTHLASVSHPQSCHWLLDPHDGRRLAVRFTALDLGFGDAVHVYDGPGPPESSRLLRSLTHFSNGKAVTVETLSGQAVVSYHTVAWSNGRGFNATYHVRGYCLPWDRPCGLGSGLGAGEGLGERCYSEAQRCDGSWDCADGTDEEDCPGCPPGHFPCGAAGTSGATACYLPADRCNYQTFCADGADERRCRHCQPGNFRCRDEKCVYETWVCDGQPDCADGSDEWDCSYVLPRKGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 56-66kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1、Manini A. et al. (2021) Screening of LRP10 mutations in Parkinson's disease patients from Italy. Parkinsonism Relat Disord. 89: 17-21. |
Background
Parkinson's disease (PD) is a neurodegenerative disorder characterized by resting tremor, bradykinesia, muscle rigidity, and abnormal gait. Parkinson's disease (PD) belongs to a family of neurodegenerative diseases characterized by alpha-synuclein accumulation in neurons. LRP10 has been associated with PD, Parkinson's disease Dementia (PDD) and Dementia with Lewy Bodies (DLB) by linkage analysis and positional cloning in an Italian family with late-onset PD. The low-density lipoprotein receptor-related protein 10 (LRP10) was recently shown to be a causal gene for PD, and different ethnic cohorts have distinct frequencies and spectrum of LRP10 variants.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.2 ★★★★★
Based on 15 reviews
Sort
Product Reviews
★★★★★ 5
Perfect Sherpa Comforter
Color: Lavender, Size: Full/Queen
Love this comforter!! Perfect material and weight for cold winter nights, beautiful color! Just wish I had found it and ordered it sooner!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 8, 2026
★★★★★ 5
In love
Color: Smoke Blue, Size: Full/Queen, Color: Smoke Blue, Size: Full/Queen
I am very weird with needing a certain kind of texture on me while I sleep, to provide me with a warmth and at ease sleep. It's super soft on both sides. Providing a certain level of coziness. I absolutely love the way this color looks- in person and on line. Overall, I love love it. The price is very reasonable. The color i chose creates a great ombiance for what i'm looking for in my room. They have so many colors to choose from. I def would give this a try. How could you not. Especially with free shipping and returns. Its a win win. I will be buying more colors in the future. Anyone who love the feel of uggs blankets. Will probably love this. The material isn't the same of course (but) it certainly works. I have an ugg throw on my bed as well and I like both. This blanket feels lighter compared to the ugg throw blanket (but) it has the same sorta softness in the inside. The ugg throw is much thicker than this blanket. Obviously, it's hard to compare the two. Hope this helps
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 14, 2023
★★★★★ 5
Beautiful comforter
Color: Light Blue, Size: Twin
This comforter set is a solid choice if comfort and warmth are your priorities. It feels luxurious without being overly expensive, making it a great upgrade for a cozy bedroom setup. Ideal for winter months or anyone who loves that extra-soft, snuggly feel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 17, 2026
★★★★★ 5
Plush and Warm
Color: Navy Blue, Size: Queen
This comforter is so warm that you can sleep as you come! In a full PJ set this blanket makes me sweat so I have learned that less is more. It is sooooo plush, and soft that it will have you not wanting to come out of bed. The size is perfect for a couple or someone who wants to feel nice and cozy like a bug in a rug. The quality of blanket is amazing as it is thick, fluffs up immediately out the package, has no smell and does not have a wrinkly appearance. I bought this to replace a feather down blanket that had my bedroom feeling like a chicken coop and it definitely does not disappoint. If you want to save on your heating bill, give a warm gift or have a plush night of sleep then this comforter is for you.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2026
★★★★★ 5
Wife and cat approved!!!
Color: Grey, Size: Queen, Color: Grey, Size: Queen
The BEDELITE Fluffy Queen Comforter has been a great addition to our bedroom. It has a soft, plush feel right out of the bag and fluffs up nicely once laid out. It strikes a nice balance of being lightweight while still keeping us warm and cozy, which is perfect for year-round use. My wife immediately noticed how soft it felt, and it really does make the bed feel more inviting at the end of the day.
What surprised me most is how much everyone in the house seems to love it—our cats practically live on the bed now because of how comfortable it is. The fabric feels gentle against the skin, and it doesn’t have that scratchy or noisy texture some budget comforters do. Overall, it’s a cozy, well-made option that delivers good warmth and comfort at a reasonable price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 2, 2025