SKU: 80086835874

GCGR Fc Chimera Protein, Human

Sale price$612.00 Regular price$680.00
Save 10%

Pay in installments of $170.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 8 - Aug 13

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

GCGR Fc Chimera Protein, HumanProduct Specification Species Human Accession P47871 1 Amino Acid Sequence Ala26 Lys136, with C terminal human IgG Fc

Product Specification


Species Human
Accession P47871-1
Amino Acid Sequence

Ala26-Lys136, with C-terminal human IgG Fc AQVMDFLFEKWKLYGDQCHHNLSLLPPPTELVCNRTFDKYSCWPDTPANTTANISCPWYLPWHHKVQHRFVFKRCGPDGQWVRGPRGQPWRDASQCQMDGEEIEVQKEVAKIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

57-67 kDa(Reducing)

Purity

>90% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

The glucagon receptor (GCGR) is a Class B GPCR that has an important role in maintenance of glucose homeostasis and, as such, is considered to be a valuable target for the treatment of diabetes. The GCGR is widely expressed and can be found in the liver, adipose tissue, heart, kidney, pancreatic islets, stomach, small intestine, thyroid, and skeletal muscle. The GCGR is coupled to the activation of adenylate cyclase via Gs, with concomitant rise in cellular cyclic AMP levels and activation of protein kinase A (PKA). GCGR mRNA has been detected in islets. In vitro/ex vivo studies suggest that glucagon potentiates insulin secretion from isolated islets, although the potency is considerably less than that of the insulin secretagogue GLP-1. Mutations of the GCGR gene are associated with congenital noninsulin-dependent diabetes, and inhibition of GCGR in vivo lowers blood glucose and improves glucose tolerance in obese diabetic mice.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 80086835874

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 22 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jeffrey Gathe
Louisville, US
★★★★★ 5
Exceptionally Clean Taste and Reliable Hydration
Size: 12 Fl Oz (Pack of 12), Number of Items: 12
I’ve tried a lot of bottled waters over the years, and Essentia consistently stands out. The taste is incredibly clean and smooth—there’s none of that mineral aftertaste you sometimes get with other brands. It genuinely feels more refreshing, especially after workouts or long days. What I appreciate most is the consistency. Every bottle tastes the same, and you can tell there’s a strong focus on quality. The higher pH and added electrolytes seem to make a difference in how hydrated I feel compared to standard bottled water. The 12 oz size is also convenient—easy to grab on the go or keep at your desk without committing to a larger bottle. And knowing the bottles are BPA and phthalate-free is an added bonus. Overall, it’s a premium water that delivers on its promise. Definitely worth it if you’re looking for something a step above the typical bottled options.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 13, 2026
H
Verified Purchase
Hemingway
Whiting, US
★★★★★ 5
Life-changing Water. Extreme statement, noted, try it & you'll get it. Kids prefer it over soda? A+
Size: 42.3 Fl Oz (Pack of 12), Number of Items: 12, Size: 42.3 Fl Oz (Pack of 12), Number of Items: 12
This is by far the best tasting water that I have ever had. When I'm really thirsty, there is only one thing that I can really take in a good amount of and not feel nauseous and that's slightly chilled Blue Gatorade. But with the Essentia, I can drink the whole 1.25L bottle in one go and actually feel satisfied. The Gatorade will give me heart burn, but the Essentia does the opposite because of its high pH, making it a base. It will relieve heart burn, it will satisfy thirst, and after the longest time of our kids drinking the filtered water from the fridge, they have start begging us if they can open a bottle of Essentia to split between time. They like it cold like mom though. I'm the only one that drinks it warm and maybe I'm the weird one, but I truly enjoy it. We've been drinking it for over a year now and feel great. I highly recommend it and suggest buying the 12x1.25L or 12 by 1.5L (in the rare cases they come up) cases. The size is convenient, it doesn't get that stale taste if you forget to put the cap on for a little while, and it's just an enjoyable way to get your daily water intake. As for the health impact, many bacteria, diseases, and even cancer, etc which I'm, thrive in an acidic environment, after 3 months of drink Essentia and a pH test, I'm at about 8 on the pH scale and have stayed that way. Just for a refreshed 0-6 is acidic, 7 is neutral, and 8-14 is alkaline or basic. Knock on wood, but I have not but I have not been sick in 3 years, just check up visits and I'm a cancer survivor in remission for 13 years now. I cannot tell you exactly when we bought the first bottle in the super-market, but it has been easily 3+ years now. A+ and a continued customer for sure. I also like that they literally fill the bottle to the top, to where you have to carefully unscrew the cap without it spilling. That says something about the company, not trying to save the ounce of water at the top of the bottle and fill it with air.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 3, 2025
R
Verified Purchase
Roxx Reviews
New York, US
★★★★★ 5
Love this water! Here's why!
Size: 42.3 Fl Oz (Pack of 12), Number of Items: 12
I am pretty picky about bottled water. I will only drink black capped water as white caps make me very ill and blue caps don't have the taste or quality of black caps (the color of caps indicate how it is collected and process). Of all the black caps, Essentia is my favorite brand. I love the strong, sturdy bottles, and prefer the larger size to help me remember to hydrate. Most people don't feel like water has affects like coffee or energy drinks, but this water is clean and provides me with a boost of alertness. In terms of the value, I think it's definitely overpriced. I don't believe water should come at such a high price, yet I still pay for this brand because of the taste, the enjoyment, my energy levels and how clean it tastes going down. And it doesn't make me ill. If you're new to understanding water, pH balances, and how water is different based on how it is processed, give this a try and experience the difference of it's effectiveness.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 3, 2026
S
Verified Purchase
Susan Battle-Williams
Pawtucket, US
★★★★★ 5
Good Water
Size: 33.8 Fl Oz (Pack of 12), Number of Items: 12
Good price. Love this brand of water - no after taste. We even use the water in our ice maker :) as well as making lemon and cucumber water for hydration and a refresher.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
E
Verified Purchase
Expanding Man
Massapequa, US
★★★★★ 5
My Son's Favorite
Size: 42.3 Fl Oz (Pack of 12), Number of Items: 12
My son loves Essentia, and it's the way I can get him to drink water instead of sugary drinks. Essentia puts together an attractive package, too. The black boxes are instantly recognizable, and the bottles actually in drink holders in our car, making portability a big plus, for us, considering he goes around with a bottle most everywhere we go. For him, he says it's the best-tasting bottled water on the market, and its quality is instantly noticeable in comparison its competitors. It keeps him hydrated, and he prefers it to such a degree that we've started buying it by the case.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026

recommand products