SKU: 90567121434

Human E-selectin, His tag

Sale price$112.50 Regular price$125.00
Save 10%

Pay in installments of $31.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human E-selectin, His tagProduct Specification Species Human Synonyms CD62 antigen like family member E, Endothelial leukocyte adhesion molecule 1 (ELAM 1), Leukocyte endothelial cell adhesion molecule 2 (LECAM2), CD62E, SELE, ELAM1 Accession P16581 Amino Acid Sequence Protein sequence (P16581, Trp22 Pro556, with C 10*His)

Product Specification


Species Human
Synonyms CD62 antigen-like family member E, Endothelial leukocyte adhesion molecule 1 (ELAM-1), Leukocyte-endothelial cell adhesion molecule 2 (LECAM2), CD62E, SELE, ELAM1
Accession P16581
Amino Acid Sequence

Protein sequence (P16581, Trp22-Pro556, with C-10*His) WSYNTSTEAMTYDEASAYCQQRYTHLVAIQNKEEIEYLNSILSYSPSYYWIGIRKVNNVWVWVGTQKPLTEEAKNWAPGEPNNRQKDEDCVEIYIKREKDVGMWNDERCSKKKLALCYTAACTNTSCSGHGECVETINNYTCKCDPGFSGLKCEQIVNCTALESPEHGSLVCSHPLGNFSYNSSCSISCDRGYLPSSMETMQCMSSGEWSAPIPACNVVECDAVTNPANGFVECFQNPGSFPWNTTCTFDCEEGFELMGAQSLQCTSSGNWDNEKPTCKAVTCRAVRQPQNGSVRCSHSPAGEFTFKSSCNFTCEEGFMLQGPAQVECTTQGQWTQQIPVCEAFQCTALSNPERGYMNCLPSASGSFRYGSSCEFSCEQGFVLKGSKRLQCGPTGEWDNEKPTCEAVRCDAVHQPPKGLVRCAHSPIGEFTYKSSCAFSCEEGFELHGSTQLECTSQGQWTEEVPSCQVVKCSSLAVPGKINMSCSGEPVFGTVCKFACPEGWTLNGSAARTCGATGHWSGLLPTCEAPTESNIPGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 60.3 kDa Observed MW: 95 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

E-selectin is a selectin cell adhesion molecule expressed only on endothelial cells activated by cytokines. During inflammation, E-selectin plays an important part in recruiting leukocytes to the site of injury. E-selectin binding to colon cancer cells correlates with increasing metastatic potential. Cancer cells of multiple tumor types bind E-selectin using glycoprotein or glycolipid ligands normally expressed on immune cells that eventually results in a tight binding between tumor cells and the activated endothelium. In addition, E-selectin may also function to recruit monocytes to primary tumors or lung metastases to promote an inflammatory pro-tumor microenvironment. E-selectin is an emerging biomarker for the metastatic potential of some cancers including colorectal cancer and recurrences. In cases of elevated blood glucose levels, such as in sepsis, E-selectin expression is higher than normal, resulting in greater microvascular permeability.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90567121434

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
TC Bhakta
Massapequa, US
★★★★★ 5
Nice strands
Size: 100ft, Style: 10 Gauge
Silky smooth marine grade wire
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2026
J
Verified Purchase
james maher
Lexington, US
★★★★★ 5
My Denon ROCKS
Style: AVR-X3800H
Pros: Nine Amps power a 9.1 or 7.1.2 or 5.2.4 speaker configuration because most of us want Atmos to work in our listening room. Plenty of power available in each amp and each configuration Atmos DTS IMAX plus any other codec or audio visual enhancement is available. Yes, 4K 8K HDR all supported. Three HDMI outputs Preamp output for up to 11 channels so any combination of preamp vs. power amplifier output is available. But not both preamp AND power amp for the same channel. And you can pick and choose which channel you want for pre amp vs power amp individually. So it can function as a AV Preamp Processor at very reasonable price point. DAC (changes Digital Signal to Analog) with all the power amplifiers you could want. High quality, including DSD, is an added bonus. Setup customizable to the nth degree. Some people might say too many options but that’s the way we get this AVR to meet our individual requirements I’ve been working with the setup for the last week and have dialed in for my needs. Still playing with the HEOS but I think it’s working well for now. Various HDMI inputs need different surround settings, I like the DTS best, but the unit has a way to include default settings for each HDMI. I’ll use default settings with my BluRay. And I’ll use direct or pure or whatever the source allows for music and streaming. And most users will want a streaming stick like the Amazon one otherwise you can’t get the Atmos signal to work. Older streamers won’t pass the Atmos signal though. The only problem with a device like this is you will buy more speakers and amps and possibly even more subwoofers, the unit will support 4 subwoofers. Enjoy So I will get back to you with comments about longer term issues. BTW the 3800 was a refurbished version for $999 . Definitely an excellent value. The online reviews are quite favorable. Even the audiophiles are still learning the nuances of setup. It’s worth the extra effort to get the most out of each user’s individual existing equipment. Cons: None. I’ve been an audio video nerd for decades so I can say that the setup effort is easily justified once the user, with user manual in hand, patiently works out the desired configuration. The audio expert online information is invaluable. I have 21MBS broadband service in my region. Even with this limitation I have more than enough added capacity with the Denon that I would never return it to seller unless someone catastrophic happened. Yes I like it that much.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 1, 2024
T
Verified Purchase
Tim J.
New York, US
★★★★★ 5
Denon Refurb AVR-X3800h.. IMPRESSIVE!
Style: AVR-X3800H, Style: AVR-X3800H
I did a lot of homework and made contact with the seller. Great communication. Turns out all of the Denon refurbished receivers are inspected or repaired by DENON, and re-certified only after passing tests upon functional as new. It arrived in a Denon box, very well insulated. Contained all NEW accessories like new & sealed. Appears flawless. The setup was easy since I have years of previous experience with surround systems. This replaced my Onkyo of 10 years. And WOW, the difference is phenomenal! Great onscreen setup + smart phone app makes it nice for making fine tuning adjustments. This model is packed with all the latest tech. The Durac Live is easily downloadable, but I am so impressed with the Audacy setup I didn’t buy the download. Great value refurbished. It comes with a one year warranty, so I purchased the 3 year assurion warranty since I saved so much money. Very happy.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2024
C
Verified Purchase
cqlink
Cuba, US
★★★★★ 1
PITA to Set-Up and Hard to Connect to WiFi
Style: AVR-X3800H
This one went right back after hours spent on set-up. Room correction software was buggy as well. I couldn't get it going and called it a day and bought the Onkyo TX-RZ50 which is equally hard to get consistent sound and and hard to cnnect to WiFi and Bluetooth. Onkyo support, however, is far superior.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 28, 2024
K
Verified Purchase
Kberkel
Grantham, US
★★★★★ 5
Great receiver, Digital Room Correction is worth it
Style: AVR-X3800H
Being a refurb, the unit seems brand new. No issues at all, working great so far after months of use. Audyssey XT32 works really well in my main seating position. Any other listening position on the couch is not great, but not the receivers issue. Just noting that there’s only so much you can fix with digital room correction, my room is the opposite of ideal. Love the multiple sub control. Dynamic EQ is fantastic also. Audyssey transformed my music. My 5.2 speaker setup is Frankenstein’d together with different brands and it was interesting to see the drastically different frequency responses of each speaker. With it all tuned, it sounds great. I find myself just sitting down and jamming to music for hours.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 8, 2024

recommand products