SKU: 90795619338

Human NFL, His tag

Sale price$99.00 Regular price$110.00
Save 10%

Pay in installments of $27.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NFL, His tagProduct Specification Species Human Synonyms Neurofilament light polypeptide, NF L, 68 kDa neurofilament protein, Neurofilament triplet L protein, NEFL, NF68 Accession P07196 Amino Acid Sequence Protein sequence (P07196, Glu397 Ser472, with C 10*His) ETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 10. 2 kDa Observed MW: 15 kDa Purity 90% by SDS PAGE

Product Specification


Species Human
Synonyms Neurofilament light polypeptide, NF-L, 68 kDa neurofilament protein, Neurofilament triplet L protein, NEFL, NF68
Accession P07196
Amino Acid Sequence

Protein sequence (P07196, Glu397-Ser472, with C-10*His) ETRLSFTSVGSITSGYSQSSQVFGRSAYGGLQTSSYLMSTRSFPSYYTSHVQEEQIEVEETIEAAKAEEAKDEPPSGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 10.2 kDa Observed MW: 15 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Neurofilament light polypeptide, also known as neurofilament light chain, abbreviated to NF-L or Nfl and with the HGNC name NEFL is a member of the intermediate filament protein family. The NF-L protein is encoded by the NEFL gene. Neurofilament light chain is a biomarker that can be measured with immunoassays in cerebrospinal fluid and plasma and reflects axonal damage in a wide variety of neurological disorders. It is a useful marker for disease monitoring in amyotrophic lateral sclerosis, multiple sclerosis, Alzheimer's disease, and more recently Huntington's disease. It is also promising marker for follow-up of patients with brain tumors. Higher levels of blood or CSF NF-L have been associated with increased mortality. The release of this protein reflects ongoing axonal loss. Methods used in different studies for NfL measurement are sandwich enzyme-linked immunosorbent assay (ELISA), electrochemiluminescence, and high-sensitive single molecule array (SIMOA).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90795619338

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Battle Creek, US
★★★★★ 5
Perfect for Toddlers
Size: 8 Toddler, Color: Navy
These are great for toddlers! Keeps my grandson’s toes safe yet cooler than sneakers for the summer. He loves them!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
S
Verified Purchase
Sashunia
Houston, US
★★★★★ 5
Great looking shoe!
Size: 11 Little Kid, Color: Tan, Size: 11 Little Kid, Color: Tan
We got these sandals specifically for our Caribbean vacation over thanksgiving break. They run true to size but I did get them one size bigger to hopefully last for next summer as well. They look great on and go with everything! My son said they feel very comfortable on his feet and he likes easy on/off due to Velcro closure.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 7, 2025
A
Verified Purchase
Amazon User
Carnegie, US
★★★★★ 5
cute and durable
these are great fit and quality. Very easy for on and off. good for wide toddler feet. my son loved them so much he melted down when they no longer fit - wish they made them in larger sizes. they held up well. only thing that fell apart after several uses was the lining on the sole peels out and has to be repositioned to stay in place when putting the shoe on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 22, 2025
M
Verified Purchase
Mama Rod
Belleville, US
★★★★★ 4
Slightly Questionable
I really like the design of these shoes and the large toe box area. I did a lot of research on quality shoes for waterplay and these ones stuck out to me. However, my son seemed very irritated by these shoes as they would leave prints on his inner foot. He seemed very uncomfortable while wearing these shoes. My son never has clothing/shoe sensory problems, but for some reason these shoes did it for him. Unfortunately, we no longer have them due to them being uncomfortable and causing red marks.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 26, 2024
L
Verified Purchase
Lucas
Waukegan, US
★★★★★ 5
Best Toddler Shoes
These shoes are among the best we've tried! They're durable (survived a whole summer of activities), easy to clean, and simple to put on. Plus, they look great! They run true to size, are wide, and flexible for little feet. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 13, 2024

recommand products