Pay in installments of $68.75 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human PINP, His tagProduct Specification Species Human Synonyms Procollagen I N Terminal Propeptide Accession P02452 Amino Acid Sequence Protein sequence(P02452, Gln23 Pro161, with C 10*His) QEEGQVEGQDEDIPPITCVQNGLRYHDRDVWKPEPCRICVCDNGKVLCDDVICDETKNCPGAEVPEGECCPVCPDGSESPTDQETTGVEGPKGDTGPRGPRGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 15. 9kDa Actual: 23kDa Purity 95% by SDS PAGE Endotoxin <1EU g
Product Specification
| Species | Human |
| Synonyms | Procollagen I N-Terminal Propeptide |
| Accession | P02452 |
| Amino Acid Sequence | Protein sequence(P02452, Gln23-Pro161, with C-10*His) |
| Expression System | HEK293 |
| Molecular Weight | Theoretical: 15.9kDa Actual:23kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Type 1 collagen is the major collagen in the body and is mainly found in mineralised bone. It has a triple helical structure consisting of one α1 and two α2 chains which are linked by disulphide bonds. The molecule is synthesised as procollagen which is proteolytically cleaved to remove both the N‐ and C- terminal parts of the molecule prior to the assembly of the remainder into the collagen matrix. The N‐ and C‐terminals are released into the circulation stoichiometrically and thus reflect the synthesis of new type 1 collagen.The amino-terminal propeptide of type I procollagen (PINP) is probably the most specific and sensitive marker of bone formation. PINP is a useful marker for monitoring the efficacy of osteoporosis therapy with anabolic agents, but it is also one of the best bone turnover markers for monitoring the efficacy of anti-resorptive therapy.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy