SKU: 29215330615

Human PIGF, His tag

Sale price$159.75 Regular price$177.50
Save 10%

Pay in installments of $44.38 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human PIGF, His tagProduct Specification Species Human Synonyms PLGF Accession P49763 2 Amino Acid Sequence Protein sequence (P49763 2, Leu19 Arg149, with C 10*His) LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRRGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Theoretical: 16. 4kDa Actual: 30kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag

Product Specification


Species Human
Synonyms PLGF
Accession P49763-2
Amino Acid Sequence

Protein sequence (P49763-2, Leu19-Arg149, with C-10*His) LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRPLREKMKPERCGDAVPRRGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Theoretical: 16.4kDa Actual: 30kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied. 

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles.

Background

Placental growth factor (PIGF) is a member of the VEGF (vascular endothelial growth factor) sub-family - a key molecule in angiogenesis and vasculogenesis, in particular during embryogenesis. The main source of PIGF during pregnancy is the placental trophoblast. PIGF is also expressed in many other tissues, including the villous trophoblast. Placental growth factor-expression within human atherosclerotic lesions is associated with plaque inflammation and neovascular growth. Serum levels of PIGF and sFlt-1 (soluble fms-like tyrosine kinase-1, also known as soluble VEGF receptor-1) are altered in women with preeclampsia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29215330615

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
I
Verified Purchase
I'm A Zon
Whiting, US
★★★★★ 5
You want this one, for power and quality and saving on AA battery costs
Color: Black
Yes. You want this one, for power and quality and saving on AA battery costs — buy it now. Don’t waste any more time comparing products. After hours, days, weeks, of researching and comparing, I ordered this one. I do not regret it. It is powerful. It was less than $25 when I bought it. It has a USB charger port and it feels solid in your hand. It has a turn-knob at the top to control the variable speed immersion blender aka milk frother aka wand frother. Charge battery fully for 2hrs before first use and then you’re all set. It works very well. It functioned as expected and then even better. Yes. It exceeded expectations. I hope it lasts a long time. It feels like it is very well made and high quality. Classiest and best wand frother I have ever owned. And I’ve owned over 3-4 in the past 10yrs. I got this one at $25 instead of the highest-rated one for $9.99 because those require AA batteries and this frother however is USB-C rechargeable! So in 1-2 years it will have paid for itself in battery costs alone. But there’s no price I can put on how enjoyable it is to use this super powerful, super smooth, high quality, wand frother.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 20, 2025
S
Verified Purchase
Sahil Samral
Charlottesville, US
★★★★★ 5
Quality Design
Color: Gray
Excellent frother/mixer Pros: - Quality feels premium. - Plenty of power to mix even with a drink packed with ice and peanut butter. Basically a mini handheld mixer. - Ease of use is great. I appreciated that this had a longer brother so I can mix drinks in taller cups. Also the grip is fantastic and it is easy very easy to change the speed with just one hand so you can hold the drink with the other. Longevity - So far it's been holding up and hasn't needed a battery replacement. Cons: None so far.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 10, 2025
M
Verified Purchase
Michelle
West Palm Beach, US
★★★★★ 5
Highly recommend!
Color: Gray
Love this frother!!! Purchased to replace an Aerolatte that stopped working after a reasonable period of use. Right out of the box, it was charged and ready to go. I’ve been using it daily for about 5 weeks on the same charge it had on arrival and it’s still going strong. Love the variable speed and easy to work with one hand. And this baby can froth! It froths far better than our old Aerolatte. Also love the rechargeable feature so no more AA batteries wasted. This handy kitchen tool makes my morning coffee a true highlight. Highly recommend the Maestri milk frother!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 18, 2026
R
Verified Purchase
RetroGirl
Carnegie, US
★★★★★ 5
Best Frother Ever!
Color: Black
Great little frother and very powerful after just one charge. I haven’t charged it since the first day and it is still going strong after 3 weeks. I use it daily for coffee froth, but have used it for mixing other things as well. It works great on mixing drink powders into water and for making salad dressing from scratch. It’s one of the best things I’ve purchased on Amazon for kitchen tools. My old frother ate through batteries and was 1/10th as powerful. This one really is amazing. Great quality heavy duty but still small machine. Extra attachment heads are also a bonus.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
T
Verified Purchase
Toni L
Natrona Heights, US
★★★★★ 4
Very good frother that gets the job done extreamly well
Color: White
I hvae used this frother primarily for smoothies and coffees. Each time, it does a wonderful job. Deducted a star for the location of the speed control which is ontop of the device. It's akward to use one handed while attempting to control the speed, athough it's advertised as making it easier. It's not!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 27, 2025

recommand products