Pay in installments of $42.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 13 - Aug 18
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
HRSVA (strain A2) post-fusion glycoProtein F0 Protein, His TagProduct Specification Species HRSV Antigen HRSVA Synonyms Fusion glycoprotein F2, Fusion glycoprotein F1 Accession P03420 Amino Acid Sequence Gln26 Leu513, with C terminal 6* His
Product Specification
| Species | HRSV |
| Antigen | HRSVA |
| Synonyms | Fusion glycoprotein F2, Fusion glycoprotein F1 |
| Accession | P03420 |
| Amino Acid Sequence | Gln26-Leu513, with C-terminal 6* His QNITEEFYQSTCSAVSKGYLSALRTGWYTSVITIELSNIKENKCNGTDAKVKLIKQELDKYKNAVTELQLLMQSTPATNNRARRELPRFMNYTLNNAKKTNVTLSKKRKRRAIASGVAVSKVLHLEGEVNKIKSALLSTNKAVVSLSNGVSVLTSKVLDLKNYIDKQLLPIVNKQSCSISNIETVIEFQQKNNRLLEITREFSVNAGVTTPVSTYMLTNSELLSLINDMPITNDQKKLMSNNVQIVRQQSYSIMSIIKEEVLAYVVQLPLYGVIDTPCWKLHTSPLCTTNTKEGSNICLTRTDRGWYCDNAGSVSFFPQAETCKVQSNRVFCDTMNSLTLPSEVNLCNVDIFNPKYDCKIMTSKTDVSSSVITSLGAIVSCYGKTKCTASNKNRGIIKTFSNGCDYVSNKGVDTVSVGNTLYYVNKQEGKSLYVKGEPIINFYDPLVFPSDEFDASISQVNEKINQSLAFIRKSDELLGGGSHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 43-45 kDa&18 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Melero J A. et al. (1997) Antigenic structure, evolution and immunobiology of human respiratory syncytial virus attachment (G) protein. J Gen Virol. 78 (10): 2411-2418. 2. Trento A. (2006) Natural history of human respiratory syncytial virus inferred from phylogenetic analysis of the attachment (G) glycoprotein with a 60-nucleotide duplication. J Virol. 80(2): 975-984. |
Background
HRSV is a member of the Pneumovirinae subfamily in the Paramyxoviridae family. It consists of a non-segmented, single-strand negative RNA genome packaged in a lipid envelope. The genome of HRSV is about 15.2 kb in length and encodes 10 genes and 11 proteins: NS1, NS2, N, P, M, SH, G, F, M2-1, M2-2, and L. The F protein and G protein are the major surface glycoproteins. Both of them can stimulate the production of neutralizing antibodies. The sequence of the F protein is highly conserved, while that of the G protein is hypervariable. Due to the genetic diversity in the G gene, sequence encoding the second hypervariable region in the C-terminal (HVR2) of the G protein has been used for genotyping of HRSV. According to the genetic characteristic and reactivity with monoclonal antibodies, HRSV is classified into 2 subgroups, A (HRSVA) and B (HRSVB). To date, there are 15 genotypes of HRSVA (GA1-GA7, SAA1, CB-A, NA1-4 and ON1-2), and 24 genotypes of HRSVB (GB1-GB4, SAB1-SAB4, URU1-2, BA1-12, GB5/CB1 and CBB).
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy