SKU: 92666966634

LAIR1/CD305 His Tag Protein, Mouse

Sale price$270.00 Regular price$300.00
Save 10%

Pay in installments of $75.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LAIR1/CD305 His Tag Protein, MouseProduct Specification Species Mouse Accession Q8BG84 Amino Acid Sequence Gln22 Tyr141, with C terminal 8*His QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTYGGGSHHHHHHHH Expression System HEK293 Molecular Weight 23 33kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer PBS, pH7. 4

Product Specification


Species Mouse
Accession Q8BG84
Amino Acid Sequence

Gln22-Tyr141, with C-terminal 8*His QEGSLPDITIFPNSSLMISQGTFVTVVCSYSDKHDLYNMVRLEKDGSTFMEKSTEPYKTEDEFEIGPVNETITGHYSCIYSKGITWSERSKTLELKVIKENVIQTPAPGPTSDTSWLKTYGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 23-33kDa (Reducing)
Purity

>95% by SDS-PAGE

Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.

Background

Leukocyte-associated immunoglobulin-like receptor-1 (LAIR-1) is a type I glycoprotein of 287 amino acids containing a single extracellular Ig-like domain followed by a stalk region connected to the single transmembrane domain and 2 cytoplasmic immunoreceptor tyrosine-based inhibitory motifs that relay the inhibitory signal. LAIR-1 is expressed on almost all immune cells, including NK cells, T cells, B cells and mono-cytes, monocyte-derived dendritic cells, eosinophils, and basophils and mast cells. LAIR-1 binds both transmembrane and extracellular matrix collagens. The mLAIR-1 gene maps to the proximal end of mouse chromosome 7 in a region syntenic with human chromosome 19q13.4 where the LRC is located. LAIR-1 are involved in controlling the balance of the immune system to prevent improper activation or overactivation, which may result in tissue damage or autoimmune diseases. LAIR1 has been shown to inhibit T and NK cell activation mediated by several activating receptors. Furthermore, it has been shown that LAIR1 can deliver an inhibiting signal on intracellular free calcium concentration and immunoglobulin (Ig) production induced by the engagement of B cell antigen receptors (BCR).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 92666966634

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Robert J. Huffine
Pawtucket, US
★★★★★ 5
Best Of The Best
Format: Hardcover
This is the best book I've ever yet read on Hebrew Syntax as was used in the Tanakh. You can't go wrong with this, even though at times, the English-language linguistical jargon may give you a headache, the authors were quick to point out that Hebrew cannot really be clearly defined with English Grammar terminology. But it's format is easy on the eyes. You will often find yourself flipping back a page or two at a list or chart, for whatever they're explaining, but I don't understand how you could have a problem with that. I first saw this at the Portland City Library in PDX, Oregon, and vowed to myself I was going to buy it, no matter what the cost. It's worth it's weight in pure platinum..!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 20, 2014
J
Verified Purchase
John Ferrer
Carnegie, US
★★★★★ 5
Hard to Beat
Format: Hardcover
Waltke's grammar is about as good as it gets with Hebrew Grammars. Considering the subject matter and its scope one has to expect a monolith like this 700pg jumbo sized monster. But this isn't just some pedantic and wordy school book, it is accessible (assuming that the reader has a basic understanding of Hebrew already), rich with Biblical examples, and comprehensive (at least as far as a grammar can be). This book has set a standard for Hebrew Grammars and is a must for the serious Hebrew student.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 3, 2005
A
Amazon Customer
San Leandro, US
★★★★★ 5
In Kathy Koch’s Words, “To get something new, you must do something new.”
Format: Paperback
Dr. Kathy out did herself with this one. I finished the book with hope, ideas, and actionable steps, to use in my relationships with my adult children. She repeats this phrase throughout her book, “To get something new, you must do something new.” I like this so much more than the definition of insanity, “doing the same thing over and over again and expecting different results," (not sure who said it first and it is not my definition). I am a creature of habit and do the same things and can be amazed when nothing changes. But as Dr. Kathy states I have to do something new, and this book gives me that new. Every chapter ends with 5 actionable steps, and guided activities to apply what was discussed. Some steps are even scripted to help when you don’t know what to say. I have 13 children. 6 have reached adulthood. 4 of them are married and we have 10 amazing grandchildren. Navigating relationships with the adult kids sometimes feels like a roller coaster ride. I can be passive aggressive and opinionated. I know better, but bad habits are hard to break. When I got the email that this book was about to be published and Dr. Kathy was looking for some to read and give an honest opinion of it, I jumped at the chance. I received a free digital copy, and as soon as it was available I bought it. I highly recommend this book. It was written to help with adult kids, but you can apply the ideas with communicating with any adults or even kids. Chapter 1 “First, The Basics” as our children become adults we are their parents (noun), but are no longer to parent (verb). Our role switches to encourager, guide, counselor, coach based on mutual trust. She reminds us that our purpose is more than just parenting. She discusses the 5 core needs of security, identity, belonging, purpose, and competence. She even gives a scripted Declaration of Release returning our children into the hands of an all powerful God. Chapter 2 “Look Honestly at Yourself” Dr. Kathy hits hard here. She tells us to lose our pride, take responsibility for our part and be open to make changes. She also tells the reader to listen to learn and not to judge. This chapter gave me so much insight into my personal relationships. Reminded me that I get defensive because I don’t want to be criticized or blamed. She guides in ways to get to the bottom of hurts by asking questions and listening. Chapter 3 “Listen More, Talk Less” No unsolicited advice. Listen to understand. Ask questions to clarify, and ask permission before giving your two cents. Hear your children. Love them. Accept them. This doesn’t mean you like or approve their choices, just acknowledge it. Focus on the present. Facts. Surrender it all to God. Chapter 4 “How to Handle Grief So It Doesn’t Handle You” Acknowledge grief, give yourself time to accept and grieve. Grieve what isn’t and accept what is. Reject lies and embrace truth. Then work on what you can. Chapter 5 “The Two Shall Become One” has all the tips for when your adult child marries. How to handle traditions, holidays, etc. Chapter 6 “The Blessings of Grandchildren” has my next favorite quote. Dr. Kathy says, “Don’t judge past by today’s wisdom.” This gem is one I have repeatedly told myself since I finished reading the book. I did the best I could at that time. I have grown, matured, learned more, and am not the same person I was. She also says that God calls me to love others, not analyze and fix them. So now that the grandchildren are here I need to learn their 8 great smarts (word, logic, picture, music, body, nature, people, and self), be active and not idolize. Chapter 7 “Close or Far away” we need to respect their home and ways. Always ask to stop by and leave judgement at the door. Instead of walking in and feeling like you should do something, instead ask “What would you like me to do.” My job is to pray and serve. Chapter 8 “The Big Stuff:Moving Home and More” addresses the need for clear communication, clear expectations and respect. Chapter 9 “ Politics, Lifestyle, and Other Hot Topics” Bottom line is to be open and approachable. If a topic comes up that can’t be discussed peacefully it is ok to say no to discussing right then. Always be respectful and stay calm. Chapter 10 “The Prodigal” This one leans a lot into giving up our control and leaning into God’s sovereignty. Releasing. Grieving. Loving unconditionally. Being available to listen, but not quick to solve, and offer unsolicited advice. Chapter 11 “Finding Hope When Life Unravels” where does our hope come from? The Lord. We cannot live in past guilt and shame. Know you did the best you could. If you did wrong, take responsibility for it. Ultimately though it is all in His hands. Sometimes we have to get out of the way and let God work in our children’s lives. We can’t. But He can. Trust in His sovereignty.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026
M
Mom of 6+4
Louisville, US
★★★★★ 5
A thoughtful and practical book, from an author we have trusted through all the stages of parenting!
Format: Paperback
When we started our family, we figured that the "hard years" would be the ones with night-time feedings, teething, potty training... As my mom later revealed, "little children, little problems...big kids, big problems." And now, as parents of 4 adults, our learning in this "parenting stage" continues, and we appreciate all the help we can get! (And we now have lots of grandkids...a whole new phase with a steep learning curve!) We met Dr Kathy years ago, at a homeschooling conference in Europe, and have closely followed her ever since. She was a huge help to our oldest who was struggling in the German school system. When we were asked if we would like an advance copy of her book about strategies as parents of adult children, we were very glad to say yes! We so appreciate her thoughtful, practical advice! This book is filled with both, and we plan to get a hard copy, to re-read and underline. And we are definitely glad to recommend it to friends in this stage of life, whether they have great relationships with their kids or ones with tough challenges.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
L
LC Medical and Support Services
Whiting, US
★★★★★ 5
Practical help for a challenging transition of parenthood
Format: Paperback
I have long been a fan of Dr. Kathy, having read several of her books as well as heard her speak at conferences. She is always down to earth with practical ideas and spiritual truths. I was provided an advance, free copy of this book to read and preview, and I must say it was such as relevant topic to me - I have two young adult children, one who is fully launched and one still at home. Full disclosure - I am only through chapter 3, but that is because I wanted to take my time and digest the applications of this book! Some ideas I am already contemplepating and implementing: - avoiding placing my child (and their happiness) as a sort of idol in my life - an echo of what I'd already sensed - I need to shift my role from parent to invided guide -humbly confronting my own assumptions and beliefs as a pathway to open dialog - tackling the hard work of bcoming an active, intentional and sensitive listener. I had a digital copy so underlining wasn't practical, but that may be good as I'd want to underline most of the book so far! Each chapter has a mixture of concepts, ideas for building skills in real life and suggested prayers. I can't wait to finish the book - I actually ordered two hard copies for my husband and I to read and discuss together. Thank you for this book!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 11, 2026

recommand products