SKU: 93306867438

Human TSLP Protein, His tag

Sale price$180.00 Regular price$200.00
Save 10%

Pay in installments of $50.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TSLP Protein, His tagProduct Specification Species Human Synonyms Thymic stromal lymphopoietin Accession Q969D9 Amino Acid Sequence Protein sequence (Q969D9, Try29 Gln159, with C His tag) YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ Expression System HEK293 Molecular Weight Predicted MW: 16. 6 kDa Observed MW: 17 25 kDa Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated

Product Specification


Species Human
Synonyms Thymic stromal lymphopoietin
Accession Q969D9
Amino Acid Sequence

Protein sequence (Q969D9, Try29-Gln159, with C-His tag) YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Expression System HEK293
Molecular Weight Predicted MW: 16.6 kDa Observed MW: 17-25 kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Thymic stromal lymphopoietin (TSLP) is a cytokine that plays a vital role in the immune system. It was first discovered in the thymus and is mainly produced by stromal cells. TSLP functions as a key mediator in initiating and regulating immune responses. It activates dendritic cells, which then stimulate the differentiation of T helper cells, especially Th2 cells. This leads to the release of various inflammatory cytokines, contributing to the development of allergic and inflammatory diseases. In addition, TSLP is involved in immune responses against certain pathogens. Its dysregulation has been associated with several immune - related disorders, making it an important target for therapeutic interventions in diseases like asthma and atopic dermatitis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 93306867438

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Gayle
Louisville, US
★★★★★ 5
My puppy LOVEs this ball
Color: Glow in the dark I, Size: Medium
I saw someone recommend this ball in a facebook group. I ordered the first one and it is now sitting somewhere under my deck and I can't find it. My dog loved it so much I had to order a second one. I think the fact there are so many tabs it makes it easy for him to grab it and run so very functional. He doesn't always like to share. The glow in the dark ability I would rate that good at all. The rest of the ball is good quality and holds up well against my aggressive chewer. Its easy to throw or kick. It isn't super hard but is holds it shape well. My dog is about 8 months old and is a mini goldendoodle. I think he was about 18lbs in the video. Perfect size for him. I would definitely recommend, I think your dog would love it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 15, 2025
C
Verified Purchase
Cover
Cuba, US
★★★★★ 5
Corgi goes crazy for this ball
Six months now, still five stars. It is still easily our Corgi’s favorite ball & she still enjoys it all kinds of ways. Rather than tiring of it she likes it even more. She really likes the tabs that make it so easy to grab & hold onto. The ball is all roughed up & torn up still but held up well & has not had to be pumped back up at all. As others noted a small manual ball pump, about 10” with i think 3 different attachments, is included with each order. The glow in the dark stuff is apparently a coating of some kind which has been totally rubbed off. I used an art pen with glow liquid to trace the pattern on the ball for a glow refresh, we’ll see how long that lasts. It is hard to find toys she likes that much, i highly recommend! Our Welsh Corgi goes nuts for this slightly smaller size soccer ball. She had a full-sized ball that we left slightly deflated so she could run with it. This one is even better than i ever would’ve guessed it would be! The tabs, including a longer tab useful as a handle for humans, make it easy for her to grab it or run all over playing keep away with it. Not interested in herding this ball when she can run all over the yard with it or carry it everywhere with her. She’s a super strong chewer in spite of being small so it is extra durable by our tough standards & it appears that it will last at least a year im guessing. Quality materials & craftsmanship. It’s held up over a month - roughed up but not excessively. The glow in the dark feature is not as bright as the photos - don’t buy it just for that - but it glows some given enough daytime sun, and a dark night so the glow can show. Only the top side of the ball that’s facing up can absorb the sunlight at a time so it’s unlikely that the entire ball could get the amount of sunlight needed to glow brightly all at once. All and all this is the best, most well used toy purchased for her during her one year with us, well worth the $$ and recommend buying it if your pet enjoys balls, keep away, herding, and/or fetch, anything like that. She also likes to hide it from me, just the right size for that.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 13, 2023
D
Verified Purchase
Dee123
Houston, US
★★★★★ 5
Pawsome product!
Color: Glow in the dark I, Size: Medium
Pawsome for our doggos! We have bought 5 because the puppy chewed the tags off. Our dogs are border / aussie mix and love the challenge of these balls. We named them "Wilson" because they treat them like their best friend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
C
Verified Purchase
Crystal Davis
Pawtucket, US
★★★★★ 4
Good ball but does not glow.
Color: Glow in the dark I, Size: Medium
My Frenchie loves this ball and it seems to be made well, but it does not glow in the dark.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 18, 2025
N
Verified Purchase
Nana
Port Orchard, US
★★★★★ 1
My Monster Dogs destroyed these balls
Color: Glow in the dark II, Size: Large
I was so excited to get two of these balls for my doodle puppies to have to play with . THEY DESTROYED THEM IN ALL OF TEN MINUTES. I don't believe that there was anything wrong with the balls. They were beautiful, high quality balls. Just not durable enough for my doodles.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026

recommand products