Pay in installments of $50.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 13 - Aug 18
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Fc γ RIIb/CD32b GST Tag Protein, HumanProduct Specification Species Human Antigen Fc RIIB CD32b Synonyms FCGR2B, FCG2, IGFR2, CDw32 Accession P31994 Amino Acid Sequence Ala46 Pro217, with N terminal GST Tag
Product Specification
| Species | Human |
| Antigen | Fc γ RIIB/CD32b |
| Synonyms | FCGR2B, FCG2, IGFR2, CDw32 |
| Accession | P31994 |
| Amino Acid Sequence | Ala46-Pro217, with N-terminal GST Tag MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKGGGSGGGSAPPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP |
| Expression System | HEK293 |
| Molecular Weight | 43-55kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | GST Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Ali Roghanian, Richard J Stopforth, Lekh N Dahal, Mark S Cragg. New revelations from an old receptor: Immunoregulatory functions of the inhibitory Fc gamma receptor, Fc γ RIIB (CD32B). J Leukoc Biol. 2018 Feb 6. Online ahead of print. |
Background
The Fc gamma receptor IIB (Fc γ RIIB/CD32B) was generated million years ago during evolution. It is the sole inhibitory receptor for IgG, and has long been associated with the regulation of humoral immunity and innate immune homeostasis. However, new and surprising functions of Fc γ RIIB are emerging. In particular, Fc γ RIIB has been shown to perform unexpected activatory roles in both immune-signaling and monoclonal antibody (mAb) immunotherapy. Furthermore, although ITIM signaling is an integral part of Fc γ RIIB regulatory activity, it is now clear that inhibition/activation of immune responses can occur independently of the ITIM. In light of these new findings, we present an overview of the established and noncanonical functions of Fc γ RIIB and discuss how this knowledge might be exploited therapeutically.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy