Pay in installments of $70.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 13 - Aug 18
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
VNN1/Vanin-1 His Tag Protein, MouseProduct Specification Species Mouse Antigen VNN1 Vanin 1 Synonyms Pantetheinase, Tiff66, Vascular Non Inflammatory Molecule 1 Accession Q9Z0K8 Amino Acid Sequence Leu24 Ser487, with C terminal 8*His
Product Specification
| Species | Mouse |
| Antigen | VNN1/Vanin-1 |
| Synonyms | Pantetheinase, Tiff66, Vascular Non-Inflammatory Molecule 1 |
| Accession | Q9Z0K8 |
| Amino Acid Sequence | Leu24-Ser487, with C-terminal 8*His LDTFLAAVYEHAVILPKDTLLPVSHSEALALMNQNLDLLEGAIVSAAKQGAHIIVTPEDGIYGVRFTRDTIYPYLEEIPDPQVNWIPCDNPKRFGSTPVQERLSCLAKNNSIYVVANMGDKKPCNTSDSHCPPDGRFQYNTDVVFDSQGKLVARYHKQNIFMGEDQFNVPMEPEFVTFDTPFGKFGVFTCFDILFHDPAVTLVTEFQVDTILFPTAWMDVLPHLAAIEFHSAWAMGMGVNFLAANLHNPSRRMTGSGIYAPDSPRVFHYDRKTQEGKLLFAQLKSHPIHSPVNWTSYASSVESTPTKTQEFQSIVFFDEFTFVELKGIKGNYTVCQNDLCCHLSYQMSEKRADEVYAFGAFDGLHTVEGQYYLQICILLKCKTTNLRTCGSSVDTAFTRFEMFSLSGTFGTRYVFPEVLLSEVKLAPGEFQVSSDGRLVSLKPTSGPVLTIGLFGRLYGKDWASGGGSHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 60-72kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. Ykelien L Boersma. The structure of vanin 1: a key enzyme linking metabolic disease and inflammation. Acta Crystallogr D Biol Crystallogr. 2014 Dec 1;70(Pt 12):3320-9. Epub 2014 Nov 28. |
Background
Vanin 1, or pantetheinase, is a glycosylphosphatidylinositol(GPI)-anchored ectoenzyme that has been shown to be widely expressed in many tissues, including the liver, kidney and gut. Pantetheinase catalyzes the hydrolysis of pantetheine to pantothenic acid (vitamin B5) and cysteamine, which together with cystamine participate in the regulation of cellular pathways involved in oxidative stress and inflammation. Germline deletion of vanin 1 in mice results in an absence of tissue cysteamine. As such, vanin 1 has been shown to both protect tissues from and sensitize tissues to damage in different disease settings. Mice that lack vanin 1 display resistance to oxidative tissue damage induced by whole-body γ-irradiation, with a reduction in apoptosis and inflammation. The absence of cellular cysteamine was associated with elevated levels of the potent antioxidant glutathione.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy