Pay in installments of $52.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 13 - Aug 18
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Frizzled-10/FZD10 Fc Chimera Protein, HumanProduct Specification Species Human Antigen Frizzled 10 FZD10 Synonyms CD350 antigen, CD350, frizzled (Drosophila) homolog 10, frizzled homolog 10 (Drosophila), Frizzled10, Frizzled 10, Fz10, FZ 10, FZD10, FzE7, hFz10 Accession Q9ULW2Y Amino Acid Sequence Ile21 Gly161, with C terminal Human IgG Fc
Product Specification
| Species | Human |
| Antigen | Frizzled-10/FZD10 |
| Synonyms | CD350 antigen, CD350, frizzled (Drosophila) homolog 10, frizzled homolog 10 (Drosophila), Frizzled10, Frizzled-10, Fz10, FZ-10, FZD10, FzE7, hFz10 |
| Accession | Q9ULW2Y |
| Amino Acid Sequence | Ile21-Gly161, with C-terminal Human IgG Fc ISSMDMERPGDGKCQPIEIPMCKDIGYNMTRMPNLMGHENQREAAIQLHEFAPLVEYGCHGHLRFFLCSLYAPMCTEQVSTPIPACRVMCEQARLKCSPIMEQFNFKWPDSLDCRKLPNKNDPNYLCMEAPNNGSDEPTRGIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Expression System | HEK293 |
| Molecular Weight | 50-55kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | Human Fc Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1． Cell Signal . 2006 Jul;18(7):934-41. Epub 2006 Feb 9. |
Background
Frizzled-10 (FZD10), also known as CD350, is a G-protein coupled receptor with seven transmembrane domains. The 205 amino acid N-terminal extracellular region of Frizzled-10 contains a cysteine-rich domain that comprises the Wnt binding domain and mediates receptor oligomerization. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. Frizzled-10 is also up-regulated in several cancers and transformed cell lines. It may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and differentiation.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy