SKU: 65750023411

NRAS, Avi&His Tag Protein

Sale price$348.30 Regular price$387.00
Save 10%

Pay in installments of $96.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

NRAS, Avi&His Tag ProteinProduct Specification Species Human Synonyms ALPS4, CMNS, N ras, NCMS, NRAS1, NS6 Accession P01111 Amino Acid Sequence M1 N172 MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLN Expression System E. coli Molecular Weight 23. 6 kDa Purity >90% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag Avi Tag, His Tag Physical

Product Specification


Species Human
Synonyms ALPS4, CMNS, N-ras, NCMS, NRAS1, NS6
Accession P01111
Amino Acid Sequence

M1-N172

MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLN

Expression System E.coli
Molecular Weight 23.6 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag Avi Tag, His Tag
Physical Appearance Liquid
Storage Buffer 50 mM Tris, 150 mM NaCl, 1 mM DTT, 10% glycerol, pH 7.5
Stability & Storage

-80℃

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 65750023411

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Mrs. H
Omaha, US
★★★★★ 5
A must for dry cracked heels.
Size: 6 Pairs - 6 Colors Assorted
I have to keep on top of my feet because the bottom of my heels get really dry. I have to soak them every 2 weeks so they don't look like horse hooves. With the spring and summer coming, the feet get drier , flip flops and sandals or any shoes without shocks really make them feel worse. These REALLY help maintain my soles beautiful and cushiony. I love to be barefoot around the house and these give the the feel of barefeet and the comfort of a sock on the heel. At night i always put lotion on my feet but can't sleep with socks because i overheat, these i can put my lotion and then a little urea stick on the heel and put them on and sleep like a baby. These need to be hanwashed and air dried to preserve the integrity of the gel on the sock. Just be aware of that. Fit wise i am a 7.5 on the wider side and these fit very well without being tight anywhere. I also put these on with flip flops and they look great and feel better too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 25, 2026
C
Verified Purchase
Cali Girl 2025
Pawtucket, US
★★★★★ 5
definitely recommend these to anyone who’s struggling with rough dry heels
Size: 6 Pairs - 6 Colors Assorted
I was pleasantly surprised by the effectiveness of these socks. They feature a soft gel-lined interior that helps absorb intense moisture from my dry heels. After wearing them for a couple of nights, I noticed a significant improvement in the texture and appearance of my heels. These socks stay in place while sleeping and don’t slip off. Additionally, I appreciate that they are reusable and can be washed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2026
R
Verified Purchase
Rosalyn of Roses the First
Chelsea, US
★★★★★ 5
Really works!
Size: 6 Pairs - 6 Colors Assorted
This is a true moisturizer sock that actually works to heal and nourish dry heels. You will definitely see a difference within the first 2 hours! The only thing for me is the scent is over bearing and too strong if your sensitive to smell. Let me know when a scentless sock are made and I'm there! 5 stars because the socks truly works.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 17, 2026
J
Verified Purchase
Julia
Lowell, US
★★★★★ 4
Seem to do what they are advertised for.
Size: 6 Pairs - 6 Colors Assorted
Price was decent. They fit fine. Decent colors. They give decent instructions of how to use them. I do feel that they give a decent support even though they're mainly for helping with dry cracked heels (which they also seem to do a decent job on). I haven't washed my first worn pair yet, but they seem like my regular socks in materials so they should hold up well.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
K
Verified Purchase
Kindle Customer
Whiting, US
★★★★★ 5
Gorgeous
Color: Rose Gold
Gives the skin a gorgeous glow. Not oily at all. Simply beautiful!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2026

recommand products